PER2 Antibody (5E6.)

Images

 
Immunocytochemistry/ Immunofluorescence: PER2 Antibody (5E6) [H00008864-M03] - Analysis of monoclonal antibody to PER2 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: PER2 Antibody (5E6) [H00008864-M03] - Detection limit for recombinant GST tagged PER2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PER2 Antibody (5E6.) Summary

Immunogen
PER2 (NP_073728, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PER2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PER2 Antibody (5E6.)

  • Circadian clock protein PERIOD 2
  • FASPS
  • hPER2
  • KIAA0347period 2
  • period (Drosophila) homolog 2
  • period circadian protein 2
  • period circadian protein homolog 2
  • period homolog 2 (Drosophila)

Background

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-31363
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PER2 Antibody (H00008864-M03) (0)

There are no publications for PER2 Antibody (H00008864-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PER2 Antibody (H00008864-M03) (0)

There are no reviews for PER2 Antibody (H00008864-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PER2 Antibody (H00008864-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PER2 Products

Bioinformatics Tool for PER2 Antibody (H00008864-M03)

Discover related pathways, diseases and genes to PER2 Antibody (H00008864-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PER2 Antibody (H00008864-M03)

Discover more about diseases related to PER2 Antibody (H00008864-M03).
 

Pathways for PER2 Antibody (H00008864-M03)

View related products by pathway.

PTMs for PER2 Antibody (H00008864-M03)

Learn more about PTMs related to PER2 Antibody (H00008864-M03).
 

Research Areas for PER2 Antibody (H00008864-M03)

Find related products by research area.

Blogs on PER2

There are no specific blogs for PER2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PER2 Antibody (5E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PER2
Uniprot