Pentraxin 3/TSG-14 Antibody (2B10) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Pentraxin 3/TSG-14 Primary Antibodies

Order Details


    • Catalog Number
      H00005806-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Pentraxin 3/TSG-14 Antibody (2B10) [DyLight 488] Summary

Immunogen
PTX3 (NP_002843 282 a.a. - 380 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV
Localization
Secreted
Specificity
PTX3 - pentraxin-related gene, rapidly induced by IL-1 beta
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTX3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pentraxin 3/TSG-14 Antibody (2B10) [DyLight 488]

  • alpha-induced protein 5
  • pentaxin-related gene, rapidly induced by IL-1 beta, tumor necrosis factor
  • Pentaxin-related protein PTX3
  • Pentraxin 3
  • pentraxin 3, long
  • pentraxin-3
  • pentraxin-related gene, rapidly induced by IL-1 beta
  • pentraxin-related protein PTX3
  • PTX3
  • TNF alpha-induced protein 5
  • TNFAIP5
  • TSG14
  • TSG-14
  • TSG-14pentaxin-related gene, rapidly induced by IL-1 beta
  • Tumor necrosis factor alpha-induced protein 5
  • tumor necrosis factor, alpha-induced protein 5
  • Tumor necrosis factor-inducible gene 14 protein
  • tumor necrosis factor-inducible protein TSG-14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2558
Species: Hu, Mu
Applications: WB, Simple Western
AF5739
Species: Hu, Mu, Rt
Applications: WB
H00004068-M01
Species: Hu
Applications: WB, ELISA
H00000712-P01
Species: Hu
AF2156
Species: Hu, Mu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl

Publications for Pentraxin 3/TSG-14 Antibody (H00005806-M02G) (0)

There are no publications for Pentraxin 3/TSG-14 Antibody (H00005806-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pentraxin 3/TSG-14 Antibody (H00005806-M02G) (0)

There are no reviews for Pentraxin 3/TSG-14 Antibody (H00005806-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pentraxin 3/TSG-14 Antibody (H00005806-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pentraxin 3/TSG-14 Products

Bioinformatics Tool for Pentraxin 3/TSG-14 Antibody (H00005806-M02G)

Discover related pathways, diseases and genes to Pentraxin 3/TSG-14 Antibody (H00005806-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pentraxin 3/TSG-14 Antibody (H00005806-M02G)

Discover more about diseases related to Pentraxin 3/TSG-14 Antibody (H00005806-M02G).
 

Pathways for Pentraxin 3/TSG-14 Antibody (H00005806-M02G)

View related products by pathway.

PTMs for Pentraxin 3/TSG-14 Antibody (H00005806-M02G)

Learn more about PTMs related to Pentraxin 3/TSG-14 Antibody (H00005806-M02G).

Blogs on Pentraxin 3/TSG-14

There are no specific blogs for Pentraxin 3/TSG-14, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pentraxin 3/TSG-14 Antibody (2B10) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PTX3
Entrez