PEDFR/PNPLA2/ATGL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PEDF R/PNPLA2/ATGL Antibody [NBP2-58046] - Staining of human cell line A549 shows localization to nucleoplasm & lipid droplets.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEDFR/PNPLA2/ATGL Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRA
Specificity
Specificity of human PEDF R/PNPLA2/ATGL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNPLA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-58046PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PEDFR/PNPLA2/ATGL Antibody

  • Adipose triglyceride lipase
  • ATGL
  • ATGL1110001C14Rik
  • Calcium-independent phospholipase A2
  • Desnutrin
  • EC 3.1.1.3
  • FP17548
  • IPLA2-zeta
  • patatin-like phospholipase domain containing 2
  • patatin-like phospholipase domain-containing protein 2
  • patatin-like phospholipase domain-containing protein 2-like
  • PEDF R
  • PEDFR
  • PEDF-R
  • Pigment epithelium-derived factor
  • PNPLA2
  • Transport-secretion protein 2
  • transport-secretion protein 2.2
  • triglyceride hydrolase
  • TTS2
  • TTS2.2
  • TTS-2.2
  • TTS2DKFZp667M109

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00051099-M01
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KO
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00008398-D01P
Species: Hu, Mu
Applications: WB
NB110-40760
Species: Hu, Mu, Rt, Po, Fi
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB110-40877
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, Dual ISH-IHC
NBP1-56853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-54611
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58046
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046) (0)

There are no publications for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046) (0)

There are no reviews for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PEDFR/PNPLA2/ATGL Products

Bioinformatics Tool for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046)

Discover related pathways, diseases and genes to PEDFR/PNPLA2/ATGL Antibody (NBP2-58046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046)

Discover more about diseases related to PEDFR/PNPLA2/ATGL Antibody (NBP2-58046).
 

Pathways for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046)

View related products by pathway.

PTMs for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046)

Learn more about PTMs related to PEDFR/PNPLA2/ATGL Antibody (NBP2-58046).
 

Research Areas for PEDFR/PNPLA2/ATGL Antibody (NBP2-58046)

Find related products by research area.

Blogs on PEDFR/PNPLA2/ATGL

There are no specific blogs for PEDFR/PNPLA2/ATGL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEDFR/PNPLA2/ATGL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNPLA2