PECI Antibody

Images

 
Western Blot: PECI Antibody [NBP1-54365] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PECI Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54365
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PECI Antibody Summary

Immunogen
Synthetic peptides corresponding to PECI(peroxisomal D3,D2-enoyl-CoA isomerase) The peptide sequence was selected from the middle region of PECI. Peptide sequence AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK.
Clonality
Polyclonal
Host
Rabbit
Gene
ECI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PECI and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PECI Antibody

  • ACBD2
  • acyl-Coenzyme A binding domain containing 2
  • D2-enoyl-CoA isomerase
  • delta(2)-enoyl-CoA isomerase
  • Delta(3)
  • Diazepam-binding inhibitor-related protein 1
  • dJ1013A10.3
  • Dodecenoyl-CoA isomerase
  • DRS-1
  • DRS1D3
  • EC 5.3.3.8
  • enoyl-CoA delta isomerase 2
  • HCA88DBI-related protein 1
  • Hepatocellular carcinoma-associated antigen 88
  • KIAA0536
  • PECI
  • Peroxisomal 3,2-trans-enoyl-CoA isomerase
  • peroxisomal D3
  • Renal carcinoma antigen NY-REN-1

Background

PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AU100345.1 1-40 41-1380 BC033841.1 11-1350 1381-1410 BQ653836.1 596-625

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-86872
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01707
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14696
Species: Hu
Applications: IHC, IHC-P
NBP1-54365
Species: Hu
Applications: WB

Publications for PECI Antibody (NBP1-54365) (0)

There are no publications for PECI Antibody (NBP1-54365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PECI Antibody (NBP1-54365) (0)

There are no reviews for PECI Antibody (NBP1-54365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PECI Antibody (NBP1-54365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PECI Products

Bioinformatics Tool for PECI Antibody (NBP1-54365)

Discover related pathways, diseases and genes to PECI Antibody (NBP1-54365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PECI Antibody (NBP1-54365)

Discover more about diseases related to PECI Antibody (NBP1-54365).
 

Pathways for PECI Antibody (NBP1-54365)

View related products by pathway.

PTMs for PECI Antibody (NBP1-54365)

Learn more about PTMs related to PECI Antibody (NBP1-54365).

Blogs on PECI

There are no specific blogs for PECI, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PECI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECI2
Uniprot