PDZRN4 Antibody


Immunohistochemistry-Paraffin: PDZRN4 Antibody [NBP1-85144] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Product Discontinued
View other related PDZRN4 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PDZRN4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PPTPPVPDICPFLLSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSS
Specificity of human PDZRN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PDZRN4 Antibody

  • DKFZp434B0417
  • IMAGE5767589
  • Ligand of Numb protein X 4
  • LNX4FLJ33777
  • PDZ domain containing ring finger 4
  • PDZ domain-containing RING finger protein 4
  • SEMACAP3-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDZRN4 Antibody (NBP1-85144) (0)

There are no publications for PDZRN4 Antibody (NBP1-85144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDZRN4 Antibody (NBP1-85144) (0)

There are no reviews for PDZRN4 Antibody (NBP1-85144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDZRN4 Antibody (NBP1-85144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PDZRN4 Products

Bioinformatics Tool for PDZRN4 Antibody (NBP1-85144)

Discover related pathways, diseases and genes to PDZRN4 Antibody (NBP1-85144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDZRN4 Antibody (NBP1-85144)

Discover more about diseases related to PDZRN4 Antibody (NBP1-85144).

Pathways for PDZRN4 Antibody (NBP1-85144)

View related products by pathway.

Research Areas for PDZRN4 Antibody (NBP1-85144)

Find related products by research area.

Blogs on PDZRN4

There are no specific blogs for PDZRN4, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PDZRN4 Antibody and receive a gift card or discount.


Gene Symbol PDZRN4