PDX-1/IPF1 Antibody (2E4.)

Images

 
There are currently no images for PDX-1/IPF1 Antibody (H00003651-M03).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2E4.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDX-1/IPF1 Antibody (2E4.) Summary

Immunogen
IPF1 (NP_000200, 109 a.a. - 208 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK
Specificity
IPF1 (2E4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDX-1/IPF1 Antibody (2E4.)

  • Glucose-sensitive factor
  • IDX1
  • IDX-1GSF
  • Insulin promoter factor 1
  • insulin promoter factor 1, homeodomain transcription factor
  • Insulin upstream factor 1
  • IPF1
  • IPF1pancreas/duodenum homeobox protein 1
  • Islet/duodenum homeobox-1
  • MODY4IUF1
  • pancreatic and duodenal homeobox 1
  • pancreatic-duodenal homeobox factor 1
  • PDX-1
  • PDX-1IPF-1
  • somatostatin transcription factor 1
  • Somatostatin-transactivating factor 1
  • STF-1IUF-1

Background

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3444
Species: Hu
Applications: WB
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
AF2614
Species: Hu
Applications: WB, ICC
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NB400-137
Species: Hu, Mu
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003651-M03
Species: Hu
Applications: ELISA

Publications for PDX-1/IPF1 Antibody (H00003651-M03) (0)

There are no publications for PDX-1/IPF1 Antibody (H00003651-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDX-1/IPF1 Antibody (H00003651-M03) (0)

There are no reviews for PDX-1/IPF1 Antibody (H00003651-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDX-1/IPF1 Antibody (H00003651-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDX-1/IPF1 Products

Bioinformatics Tool for PDX-1/IPF1 Antibody (H00003651-M03)

Discover related pathways, diseases and genes to PDX-1/IPF1 Antibody (H00003651-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDX-1/IPF1 Antibody (H00003651-M03)

Discover more about diseases related to PDX-1/IPF1 Antibody (H00003651-M03).
 

Pathways for PDX-1/IPF1 Antibody (H00003651-M03)

View related products by pathway.

PTMs for PDX-1/IPF1 Antibody (H00003651-M03)

Learn more about PTMs related to PDX-1/IPF1 Antibody (H00003651-M03).
 

Research Areas for PDX-1/IPF1 Antibody (H00003651-M03)

Find related products by research area.

Blogs on PDX-1/IPF1

There are no specific blogs for PDX-1/IPF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDX-1/IPF1 Antibody (2E4.) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDX1
Entrez
OMIM
Uniprot