PDSS2 Antibody


Western Blot: PDSS2 Antibody [NBP1-52889] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related PDSS2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PDSS2 Antibody Summary

Synthetic peptides corresponding to PDSS2(prenyl (decaprenyl) diphosphate synthase, subunit 2) The peptide sequence was selected from the C terminal of PDSS2. Peptide sequence IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS.
This product is specific to Subunit or Isoform: 2.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDSS2 and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDSS2 Antibody

  • All-trans-decaprenyl-diphosphate synthase subunit 2
  • bA59I9.3
  • C6orf210decaprenyl-diphosphate synthase subunit 2
  • Candidate tumor suppressor protein
  • chromosome 6 open reading frame 210
  • Decaprenyl pyrophosphate synthase subunit 2
  • decaprenyl pyrophosphate synthetase subunit 2
  • DLP1hDLP1
  • EC
  • prenyl (decaprenyl) diphosphate synthase, subunit 2
  • subunit 2 of decaprenyl diphosphate synthase


The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 (PDSS1; MIM 607429) and DLP1 (PDSS2) that produces Q10 ubiquinone.The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 (PDSS1; MIM 607429) and DLP1 (PDSS2) that produces Q10 ubiquinone (Saiki et al., 2005 [PubMed 16262699]).[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-24 DC341808.1 2-25 25-1292 BC039906.1 11-1278 1293-2534 AL832290.1 98-1339 2535-2535 BC039906.1 2521-2521 2536-3522 AL832290.1 1340-2326 3523-3568 AL832290.1 2328-2373


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Dr
Applications: EM, PEP-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for PDSS2 Antibody (NBP1-52889) (0)

There are no publications for PDSS2 Antibody (NBP1-52889).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDSS2 Antibody (NBP1-52889) (0)

There are no reviews for PDSS2 Antibody (NBP1-52889). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDSS2 Antibody (NBP1-52889) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PDSS2 Products

Bioinformatics Tool for PDSS2 Antibody (NBP1-52889)

Discover related pathways, diseases and genes to PDSS2 Antibody (NBP1-52889). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDSS2 Antibody (NBP1-52889)

Discover more about diseases related to PDSS2 Antibody (NBP1-52889).

Pathways for PDSS2 Antibody (NBP1-52889)

View related products by pathway.

PTMs for PDSS2 Antibody (NBP1-52889)

Learn more about PTMs related to PDSS2 Antibody (NBP1-52889).

Blogs on PDSS2

There are no specific blogs for PDSS2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PDSS2 Antibody and receive a gift card or discount.


Gene Symbol PDSS2