PDHX Antibody

Images

 
Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in human stomach.
Immunocytochemistry/ Immunofluorescence: PDHX Antibody [H00008050-B01P] - Analysis of purified antibody to PDHX on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: PDHX Antibody [H00008050-B01P] - expression in transfected 293T cell line. Lane 1: PDHX transfected lysate(55.11 KDa). Lane 2: Non-transfected lysate.
Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in HepG2.
Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in transfected 293T cell line by PDHX polyclonal antibody. Lane 1: PDHX transfected lysate(55.11 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDHX Antibody Summary

Immunogen
PDHX (AAH10389.1, 1 a.a. - 501 a.a.) full-length human protein. MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PDHX
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDHX Antibody

  • Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenasecomplex
  • DLDBP
  • E3-binding protein
  • E3BP
  • E3BP1
  • E3BPpyruvate dehydrogenase complex, E3-binding protein subunit
  • OPDX
  • PDHX
  • PDX1
  • PDX1Lipoyl-containing pyruvate dehydrogenase complex component X
  • proX
  • proXpyruvate dehydrogenase complex, lipoyl-containing component X
  • pyruvate dehydrogenase complex, component X
  • pyruvate dehydrogenase protein X component, mitochondrial

Background

The PDHX gene encodes component X of the pyruvate dehydrogenase (PDH) complex. For a detailed description of the pyruvate dehydrogenase complex, see MIM 300502. The mammalian PDH complex differs from that in E. coli and from the other mammalian alpha-keto acid dehydrogenases by the presence of a 53-kD protein called protein X. Component X binds to the E3 (MIM 238331) component of the PDH complex (Robinson et al., 1990 [PubMed 2112155]; Aral et al., 1997 [PubMed 9399911]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3444
Species: Hu
Applications: WB
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2614
Species: Hu
Applications: WB, ICC
AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00256297-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDHX Antibody (H00008050-B01P) (0)

There are no publications for PDHX Antibody (H00008050-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDHX Antibody (H00008050-B01P) (0)

There are no reviews for PDHX Antibody (H00008050-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDHX Antibody (H00008050-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDHX Products

Bioinformatics Tool for PDHX Antibody (H00008050-B01P)

Discover related pathways, diseases and genes to PDHX Antibody (H00008050-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDHX Antibody (H00008050-B01P)

Discover more about diseases related to PDHX Antibody (H00008050-B01P).
 

Pathways for PDHX Antibody (H00008050-B01P)

View related products by pathway.

PTMs for PDHX Antibody (H00008050-B01P)

Learn more about PTMs related to PDHX Antibody (H00008050-B01P).
 

Research Areas for PDHX Antibody (H00008050-B01P)

Find related products by research area.

Blogs on PDHX

There are no specific blogs for PDHX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDHX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDHX
Entrez
Uniprot