PDE8A Antibody

Images

 
Western Blot: PDE8A Antibody [NBP1-69109] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Details

Summary
Product Discontinued
View other related PDE8A Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69109
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PDE8A Antibody Summary

Immunogen
Synthetic peptides corresponding to PDE8A (phosphodiesterase 8A) The peptide sequence was selected from the C terminal of PDE8A. Peptide sequence VSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPK.
Clonality
Polyclonal
Host
Rabbit
Gene
PDE8A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDE8A and was validated on Western blot.
Theoretical MW
88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDE8A Antibody

  • cAMP-specific cyclic nucleotide phosphodiesterase 8A
  • EC 3.1.4.17
  • FLJ16150
  • high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
  • high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A
  • HsT19550
  • phosphodiesterase 8A

Background

Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000). See MIM 171885.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86280
Species: Hu
Applications: IHC, IHC-P
NBP1-83275
Species: Hu
Applications: IHC, IHC-P
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-00641
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46355
Species: Hu
Applications: WB, IHC
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-325
Species: Hu
Applications: WB, ChIP, IP
NBP2-13541
Species: Hu, Mu
Applications: Simple Western, IHC, IHC-P
NBP1-32341
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69109
Species: Hu
Applications: WB

Publications for PDE8A Antibody (NBP1-69109) (0)

There are no publications for PDE8A Antibody (NBP1-69109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE8A Antibody (NBP1-69109) (0)

There are no reviews for PDE8A Antibody (NBP1-69109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE8A Antibody (NBP1-69109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE8A Products

Bioinformatics Tool for PDE8A Antibody (NBP1-69109)

Discover related pathways, diseases and genes to PDE8A Antibody (NBP1-69109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE8A Antibody (NBP1-69109)

Discover more about diseases related to PDE8A Antibody (NBP1-69109).
 

Pathways for PDE8A Antibody (NBP1-69109)

View related products by pathway.

PTMs for PDE8A Antibody (NBP1-69109)

Learn more about PTMs related to PDE8A Antibody (NBP1-69109).
 

Research Areas for PDE8A Antibody (NBP1-69109)

Find related products by research area.

Blogs on PDE8A

There are no specific blogs for PDE8A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE8A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE8A