PDE3B Antibody

Images

 
Immunohistochemistry-Paraffin: PDE3B Antibody [NBP1-83279] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Product Details

Summary
Product Discontinued
View other related PDE3B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83279
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PDE3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLHPRLSSAAEEKVPVIRPRRRSSCVSLGETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE3B Antibody

  • CGIP1
  • CGI-PDE B
  • cGIPDE1
  • cGMP-inhibited 3'-5'-cyclic phosphodiesterase B
  • Cyclic GMP-inhibited phosphodiesterase B
  • cyclic nucleotide phosphodiesterase
  • EC 3.1.4
  • EC 3.1.4.17
  • HcGIP1
  • phosphodiesterase 3B, cGMP-inhibited

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PDE3B Antibody (NBP1-83279) (0)

There are no publications for PDE3B Antibody (NBP1-83279).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE3B Antibody (NBP1-83279) (0)

There are no reviews for PDE3B Antibody (NBP1-83279). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDE3B Antibody (NBP1-83279) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE3B Products

Bioinformatics Tool for PDE3B Antibody (NBP1-83279)

Discover related pathways, diseases and genes to PDE3B Antibody (NBP1-83279). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE3B Antibody (NBP1-83279)

Discover more about diseases related to PDE3B Antibody (NBP1-83279).
 

Pathways for PDE3B Antibody (NBP1-83279)

View related products by pathway.

PTMs for PDE3B Antibody (NBP1-83279)

Learn more about PTMs related to PDE3B Antibody (NBP1-83279).

Blogs on PDE3B

There are no specific blogs for PDE3B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE3B