PDE1A Antibody

Images

 
Western Blot: PDE1A Antibody [NBP1-68977] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PDE1A Primary Antibodies

Order Details


    • Catalog Number
      NBP1-68977
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PDE1A Antibody Summary

Immunogen
Synthetic peptides corresponding to PDE1A (phosphodiesterase 1A, calmodulin-dependent) The peptide sequence was selected from the C terminal of PDE1A. Peptide sequence AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET.
Clonality
Polyclonal
Host
Rabbit
Gene
PDE1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDE1A and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDE1A Antibody

  • 3'-5' cyclic nucleotide phosphodiesterase
  • 61 kDa Cam-PDE
  • calcium/calmodulin-dependent 3'-5'-cyclic nucleotide phosphodiesterase 1A
  • calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase
  • calmodulin-dependent phosphodiesterase
  • Cam-PDE 1A
  • EC 3.1.4
  • EC 3.1.4.17
  • HCAM1
  • hCam-1
  • HSPDE1A
  • MGC26303
  • phosphodiesterase 1A, calmodulin-dependent
  • phosphodiesterase-1A

Background

PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37404
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85919
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83275
Species: Hu
Applications: IHC, IHC-P
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for PDE1A Antibody (NBP1-68977) (0)

There are no publications for PDE1A Antibody (NBP1-68977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE1A Antibody (NBP1-68977) (0)

There are no reviews for PDE1A Antibody (NBP1-68977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE1A Antibody (NBP1-68977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE1A Products

Bioinformatics Tool for PDE1A Antibody (NBP1-68977)

Discover related pathways, diseases and genes to PDE1A Antibody (NBP1-68977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE1A Antibody (NBP1-68977)

Discover more about diseases related to PDE1A Antibody (NBP1-68977).
 

Pathways for PDE1A Antibody (NBP1-68977)

View related products by pathway.

PTMs for PDE1A Antibody (NBP1-68977)

Learn more about PTMs related to PDE1A Antibody (NBP1-68977).

Blogs on PDE1A

There are no specific blogs for PDE1A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE1A
Uniprot