PDCD7 Antibody

Images

 
Western Blot: PDCD7 Antibody [NBP1-59082] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDCD7 Antibody Summary

Immunogen
Synthetic peptides corresponding to PDCD7(programmed cell death 7) The peptide sequence was selected from the middle region of PDCD7. Peptide sequence YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDCD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDCD7 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDCD7 Antibody

  • apoptosis-related protein ES18
  • ES18programmed cell death protein 7
  • FLJ54213
  • HES18
  • MGC22015
  • programmed cell death 7
  • U11/U12 snRNP 59K

Background

PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramid

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-57521
Species: Hu
Applications: ICC/IF
NBP2-01854
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NB100-465
Species: Hu
Applications: WB, IHC-P
NBP1-79438
Species: Hu
Applications: WB
AF7276
Species: Hu
Applications: WB

Publications for PDCD7 Antibody (NBP1-59082) (0)

There are no publications for PDCD7 Antibody (NBP1-59082).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDCD7 Antibody (NBP1-59082) (0)

There are no reviews for PDCD7 Antibody (NBP1-59082). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDCD7 Antibody (NBP1-59082) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDCD7 Products

Bioinformatics Tool for PDCD7 Antibody (NBP1-59082)

Discover related pathways, diseases and genes to PDCD7 Antibody (NBP1-59082). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDCD7 Antibody (NBP1-59082)

Discover more about diseases related to PDCD7 Antibody (NBP1-59082).
 

Pathways for PDCD7 Antibody (NBP1-59082)

View related products by pathway.

Research Areas for PDCD7 Antibody (NBP1-59082)

Find related products by research area.

Blogs on PDCD7

There are no specific blogs for PDCD7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDCD7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD7
Uniprot