Recombinant Human PD-1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PD-1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human PD-1

Source: Wheat Germ

Amino Acid Sequence: MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PDCD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00005133-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PD-1 Protein

  • CD279 antigen
  • CD279
  • hPD-1
  • PD-1
  • PD1hPD-l
  • PDCD1
  • programmed cell death 1
  • programmed cell death protein 1
  • Protein PD-1
  • SLEB2

Background

PDCD1 - programmed cell death 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-76769
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB69752
Species: Hu
Applications: B/N, Flow, CyTOF-ready
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2365
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB141
Species: Hu
Applications: WB, Flow, CyTOF-ready, KO, Neut

Publications for PD-1 Partial Recombinant Protein (H00005133-Q01)(2)

Reviews for PD-1 Partial Recombinant Protein (H00005133-Q01) (0)

There are no reviews for PD-1 Partial Recombinant Protein (H00005133-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PD-1 Partial Recombinant Protein (H00005133-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PD-1 Partial Recombinant Protein (H00005133-Q01)

Discover related pathways, diseases and genes to PD-1 Partial Recombinant Protein (H00005133-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PD-1 Partial Recombinant Protein (H00005133-Q01)

Discover more about diseases related to PD-1 Partial Recombinant Protein (H00005133-Q01).
 

Pathways for PD-1 Partial Recombinant Protein (H00005133-Q01)

View related products by pathway.

PTMs for PD-1 Partial Recombinant Protein (H00005133-Q01)

Learn more about PTMs related to PD-1 Partial Recombinant Protein (H00005133-Q01).
 

Research Areas for PD-1 Partial Recombinant Protein (H00005133-Q01)

Find related products by research area.

Blogs on PD-1.

Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

Customers Who Bought This Also Bought

PD-1 Blocking Peptide
NBP1-77276PEP

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PD-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PDCD1
Entrez