Novus Biologicals products are now on bio-techne.com

PCYOX1 Antibody

Images

 
Western Blot: PCYOX1 Antibody [NBP2-88024] - Host: Rabbit. Target Name: PCYOX1. Sample Tissue: Human Large Intestine Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

PCYOX1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PCYOX1. Peptide sequence: INSIGIVPSVREKEDPEPSTDGTYVWKIFSQETLTKAQILKLFLSYDYAV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PCYOX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PCYOX1 Antibody

  • EC 1.8.3.5
  • KIAA0908PCL1Prenylcysteine lyase
  • prenylcysteine oxidase 1

Background

Prenylcysteine is released during the degradation of prenylated proteins. PCYOX1 catalyzes the degradation of prenylcysteine to yield free cysteines and a hydrophobic isoprenoid product (Tschantz et al., 1999 (PubMed 10585463)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6846
Species: Hu
Applications: IHC
NBP2-45388
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-48820
Species: Hu
Applications: IHC, IHC-P
291-G1
Species: Hu
Applications: BA
H00007702-M01
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
H00009033-M01
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
AF743
Species: Mu
Applications: CyTOF-ready, Flow, WB
AF7558
Species: Hu, Mu, Rt
Applications: IHC, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-43782
Species: Hu
Applications: WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-62583
Species: Hu
Applications: WB
NBP3-04850
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
H00002770-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-86589
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-88024
Species: Hu
Applications: WB

Publications for PCYOX1 Antibody (NBP2-88024) (0)

There are no publications for PCYOX1 Antibody (NBP2-88024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCYOX1 Antibody (NBP2-88024) (0)

There are no reviews for PCYOX1 Antibody (NBP2-88024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCYOX1 Antibody (NBP2-88024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCYOX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCYOX1