Recombinant Human PCF11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PCF11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1465-1555 of Human PCF11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCF11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PCF11 Protein

  • KIAA0824PCF11p homolog
  • PCF11, cleavage and polyadenylation factor II subunit, homolog (S. cerevisiae)
  • PCF11, cleavage and polyadenylation factor II subunit, homolog
  • PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)
  • pre-mRNA cleavage complex 2 protein Pcf11
  • Pre-mRNA cleavage complex II protein Pcf11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2690
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ICC
NBP2-19473
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF1726
Species: Hu
Applications: WB, IHC, ICC
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57318
Species: Hu
Applications: ICC/IF
NBP2-31564
Species: Hu
Applications: WB, IHC, IHC-P
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009098-M01
Species: Hu
Applications: WB, ELISA
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051585-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PCF11 Partial Recombinant Protein (H00051585-Q01) (0)

There are no publications for PCF11 Partial Recombinant Protein (H00051585-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCF11 Partial Recombinant Protein (H00051585-Q01) (0)

There are no reviews for PCF11 Partial Recombinant Protein (H00051585-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCF11 Partial Recombinant Protein (H00051585-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PCF11 Products

PCF11 H00051585-Q01

Bioinformatics Tool for PCF11 Partial Recombinant Protein (H00051585-Q01)

Discover related pathways, diseases and genes to PCF11 Partial Recombinant Protein (H00051585-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCF11 Partial Recombinant Protein (H00051585-Q01)

Discover more about diseases related to PCF11 Partial Recombinant Protein (H00051585-Q01).
 

Pathways for PCF11 Partial Recombinant Protein (H00051585-Q01)

View related products by pathway.

PTMs for PCF11 Partial Recombinant Protein (H00051585-Q01)

Learn more about PTMs related to PCF11 Partial Recombinant Protein (H00051585-Q01).

Blogs on PCF11

There are no specific blogs for PCF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PCF11 Antibody
NBP2-58854
Spt6 Antibody
NB100-2582

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PCF11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCF11