PCBD2 Antibody

Images

 
Western Blot: PCBD2 Antibody [NBP1-85281] - Analysis in control (vector only transfected HEK293T lysate) and PCBD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: PCBD2 Antibody [NBP1-85281] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: PCBD2 Antibody [NBP1-85281] - Staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.

Product Details

Summary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCBD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCBD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCBD2 Protein (NBP1-85281PEP)
Publications
Read Publication using NBP1-85281.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCBD2 Antibody

  • 4-alpha-hydroxy-tetrahydropterin dehydratase 2
  • DCOH2DCOHMPHS2,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2
  • DcoH-like protein DCoHm
  • dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle
  • dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1)
  • Dimerization cofactor of hepatocyte nuclear factor 1 from muscle
  • EC 4.2.1.96
  • HNF-1-alpha dimerization cofactor
  • PHS 2
  • pterin-4 alpha-carbinolamine dehydratase 2
  • pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2
  • pterin-4-alpha-carbinolamine dehydratase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PAGE
NBP2-93878
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-33464
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87970
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1107
Species: Mu
Applications: WB, IHC
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00005498-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-67584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00051177-B01P
Species: Hu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for PCBD2 Antibody (NBP1-85281)(1)

Reviews for PCBD2 Antibody (NBP1-85281) (0)

There are no reviews for PCBD2 Antibody (NBP1-85281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCBD2 Antibody (NBP1-85281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PCBD2 Products

Bioinformatics Tool for PCBD2 Antibody (NBP1-85281)

Discover related pathways, diseases and genes to PCBD2 Antibody (NBP1-85281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCBD2 Antibody (NBP1-85281)

Discover more about diseases related to PCBD2 Antibody (NBP1-85281).

Blogs on PCBD2

There are no specific blogs for PCBD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCBD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCBD2