PCAF Antibody (5E5.) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related PCAF Primary Antibodies

Order Details


    • Catalog Number
      H00008850-M06FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PCAF Antibody (5E5.) [DyLight 680] Summary

Immunogen
PCAF (AAH60823 353 a.a. - 452 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME
Specificity
PCAF (5E5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KAT2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCAF Antibody (5E5.) [DyLight 680]

  • CREBBP-associated factor
  • EC 2.3.1.48
  • GCN5
  • GCN5L
  • Histone acetylase PCAF
  • histone acetyltransferase KAT2B
  • Histone acetyltransferase PCAF
  • K(lysine) acetyltransferase 2B
  • KAT2B
  • Lysine acetyltransferase 2B
  • P
  • P/CAFGCN5
  • P300/CBP-associated factorCAF
  • PCAF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-60052
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P

Publications for PCAF Antibody (H00008850-M06FR) (0)

There are no publications for PCAF Antibody (H00008850-M06FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCAF Antibody (H00008850-M06FR) (0)

There are no reviews for PCAF Antibody (H00008850-M06FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCAF Antibody (H00008850-M06FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCAF Products

Bioinformatics Tool for PCAF Antibody (H00008850-M06FR)

Discover related pathways, diseases and genes to PCAF Antibody (H00008850-M06FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCAF Antibody (H00008850-M06FR)

Discover more about diseases related to PCAF Antibody (H00008850-M06FR).
 

Pathways for PCAF Antibody (H00008850-M06FR)

View related products by pathway.

PTMs for PCAF Antibody (H00008850-M06FR)

Learn more about PTMs related to PCAF Antibody (H00008850-M06FR).
 

Research Areas for PCAF Antibody (H00008850-M06FR)

Find related products by research area.

Blogs on PCAF

There are no specific blogs for PCAF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCAF Antibody (5E5.) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol KAT2B
Entrez