PCAF Antibody (1E3.)


Western Blot: PCAF Antibody (1E3) [H00008850-M13] - Analysis of PCAF expression in MES-SA/Dx5 (Cat # L021V1).

Product Details

Product Discontinued
View other related PCAF Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PCAF Antibody (1E3.) Summary

PCAF (NP_003875 367 a.a. - 432 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLE
PCAF - p300/CBP-associated factor (1E3)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCAF Antibody (1E3.)

  • CREBBP-associated factor
  • EC
  • GCN5
  • GCN5L
  • Histone acetylase PCAF
  • histone acetyltransferase KAT2B
  • Histone acetyltransferase PCAF
  • K(lysine) acetyltransferase 2B
  • KAT2B
  • Lysine acetyltransferase 2B
  • P
  • P300/CBP-associated factorCAF
  • PCAF


CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P

Publications for PCAF Antibody (H00008850-M13) (0)

There are no publications for PCAF Antibody (H00008850-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCAF Antibody (H00008850-M13) (0)

There are no reviews for PCAF Antibody (H00008850-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCAF Antibody (H00008850-M13) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCAF Products

Bioinformatics Tool for PCAF Antibody (H00008850-M13)

Discover related pathways, diseases and genes to PCAF Antibody (H00008850-M13). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCAF Antibody (H00008850-M13)

Discover more about diseases related to PCAF Antibody (H00008850-M13).

Pathways for PCAF Antibody (H00008850-M13)

View related products by pathway.

PTMs for PCAF Antibody (H00008850-M13)

Learn more about PTMs related to PCAF Antibody (H00008850-M13).

Research Areas for PCAF Antibody (H00008850-M13)

Find related products by research area.

Blogs on PCAF

There are no specific blogs for PCAF, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PCAF Antibody (1E3.) and receive a gift card or discount.


Gene Symbol KAT2B