PC1/3 Antibody (3D2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related PC1/3 Primary Antibodies

Order Details


    • Catalog Number
      H00005122-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PC1/3 Antibody (3D2) [DyLight 488] Summary

Immunogen
PCSK1 (NP_000430 652 a.a. - 753 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Specificity
PCSK1 (3D2)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCSK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PC1/3 Antibody (3D2) [DyLight 488]

  • EC 3.4.21
  • EC 3.4.21.93
  • NEC 1
  • PC1BMIQ12
  • PC3NEC1neuroendocrine convertase 1
  • Prohormone convertase 1
  • prohormone convertase 3
  • Proprotein convertase 1
  • proprotein convertase subtilisin/kexin type 1
  • SPC3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
H00005122-M02G
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PC1/3 Antibody (H00005122-M02G) (0)

There are no publications for PC1/3 Antibody (H00005122-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PC1/3 Antibody (H00005122-M02G) (0)

There are no reviews for PC1/3 Antibody (H00005122-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PC1/3 Antibody (H00005122-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PC1/3 Products

Bioinformatics Tool for PC1/3 Antibody (H00005122-M02G)

Discover related pathways, diseases and genes to PC1/3 Antibody (H00005122-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PC1/3 Antibody (H00005122-M02G)

Discover more about diseases related to PC1/3 Antibody (H00005122-M02G).
 

Pathways for PC1/3 Antibody (H00005122-M02G)

View related products by pathway.

PTMs for PC1/3 Antibody (H00005122-M02G)

Learn more about PTMs related to PC1/3 Antibody (H00005122-M02G).
 

Research Areas for PC1/3 Antibody (H00005122-M02G)

Find related products by research area.

Blogs on PC1/3

There are no specific blogs for PC1/3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PC1/3 Antibody (3D2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK1