PC1/3 Antibody (3D2)

Images

 
Western Blot: PC1/3 Antibody (3D2) [H00005122-M02] - PCSK1 monoclonal antibody (M02), clone 3D2. Analysis of PCSK1 expression in Raw 264.7.
Immunocytochemistry/ Immunofluorescence: PC1/3 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: PC1/3 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: PC1/3 Antibody (3D2) [H00005122-M02] - PCSK1 monoclonal antibody (M02), clone 3D2 Analysis of PCSK1 expression in HeLa.
Western Blot: PC1/3 Antibody (3D2) [H00005122-M02] - PCSK1 monoclonal antibody (M02), clone 3D2. Analysis of PCSK1 expression in PC-12.
Western Blot: PC1/3 Antibody (3D2) [H00005122-M02] - PCSK1 monoclonal antibody (M02), clone 3D2. Analysis of PCSK1 expression in NIH/3T3.
Sandwich ELISA: PC1/3 Antibody (3D2) [H00005122-M02] - Detection limit for recombinant GST tagged PCSK1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
3D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PC1/3 Antibody (3D2) Summary

Immunogen
PCSK1 (NP_000430 652 a.a. - 753 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Specificity
PCSK1 (3D2)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PCSK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using
H00005122-M02 in the following applications:

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PC1/3 Antibody (3D2)

  • EC 3.4.21
  • EC 3.4.21.93
  • NEC 1
  • PC1BMIQ12
  • PC3NEC1neuroendocrine convertase 1
  • Prohormone convertase 1
  • prohormone convertase 3
  • Proprotein convertase 1
  • proprotein convertase subtilisin/kexin type 1
  • SPC3

Background

The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a type I proinsulin-processing enzyme that plays a key role in regulating insulin biosynthesis. It is also known to cleave proopiomelanocortin, prorenin, proenkephalin, prodynorphin, prosomatostatin and progastrin. Mutations in this gene are thought to cause obesity. This encoded protein is associated with carcinoid tumors. The use of alternate polyadenylation sites has been found for this gene. Multiple alternatively spliced transcript variants have been described for this gene but their full length nature is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP, B/N
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for PC1/3 Antibody (H00005122-M02)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PC1/3 Antibody (H00005122-M02) (0)

There are no reviews for PC1/3 Antibody (H00005122-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PC1/3 Antibody (H00005122-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PC1/3 Antibody (H00005122-M02)

Discover related pathways, diseases and genes to PC1/3 Antibody (H00005122-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PC1/3 Antibody (H00005122-M02)

Discover more about diseases related to PC1/3 Antibody (H00005122-M02).
 

Pathways for PC1/3 Antibody (H00005122-M02)

View related products by pathway.

PTMs for PC1/3 Antibody (H00005122-M02)

Learn more about PTMs related to PC1/3 Antibody (H00005122-M02).
 

Research Areas for PC1/3 Antibody (H00005122-M02)

Find related products by research area.

Blogs on PC1/3

There are no specific blogs for PC1/3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PC1/3 Antibody (3D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK1
Entrez
OMIM
Uniprot