PBX2 Antibody (2E9.) [Alexa Fluor® 488]



Product Details

Product Discontinued
View other related PBX2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PBX2 Antibody (2E9.) [Alexa Fluor® 488] Summary

PBX2 (NP_002577 354 a.a. - 430 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
PBX2 - pre-B-cell leukemia transcription factor 2
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
IgG purified


Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for PBX2 Antibody (2E9.) [Alexa Fluor® 488]

  • G17Homeobox protein PBX2
  • HOX12homeobox 12
  • pre-B-cell leukemia homeobox 2
  • pre-B-cell leukemia transcription factor 2
  • Protein G17


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi

Publications for PBX2 Antibody (H00005089-M01AF488) (0)

There are no publications for PBX2 Antibody (H00005089-M01AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBX2 Antibody (H00005089-M01AF488) (0)

There are no reviews for PBX2 Antibody (H00005089-M01AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PBX2 Antibody (H00005089-M01AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PBX2 Products

Bioinformatics Tool for PBX2 Antibody (H00005089-M01AF488)

Discover related pathways, diseases and genes to PBX2 Antibody (H00005089-M01AF488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBX2 Antibody (H00005089-M01AF488)

Discover more about diseases related to PBX2 Antibody (H00005089-M01AF488).

Pathways for PBX2 Antibody (H00005089-M01AF488)

View related products by pathway.

PTMs for PBX2 Antibody (H00005089-M01AF488)

Learn more about PTMs related to PBX2 Antibody (H00005089-M01AF488).

Blogs on PBX2

There are no specific blogs for PBX2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PBX2 Antibody (2E9.) [Alexa Fluor® 488] and receive a gift card or discount.


Gene Symbol PBX2