PBX1 Antibody (4A2) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related PBX1 Primary Antibodies

Order Details


    • Catalog Number
      H00005087-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PBX1 Antibody (4A2) [PerCP] Summary

Immunogen
PBX1 (NP_002576 213 a.a. - 321 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS
Specificity
PBX1 - pre-B-cell leukemia transcription factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PBX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PBX1 Antibody (4A2) [PerCP]

  • DKFZp686B09108
  • Homeobox protein PBX1
  • Homeobox protein PRL
  • MGC126627
  • Pre-B cell leukemia transcription factor-1
  • pre-B-cell leukemia homeobox 1
  • pre-B-cell leukemia transcription factor 1
  • PRL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-46376
Species: Hu
Applications: WB, IHC

Publications for PBX1 Antibody (H00005087-M01PCP) (0)

There are no publications for PBX1 Antibody (H00005087-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBX1 Antibody (H00005087-M01PCP) (0)

There are no reviews for PBX1 Antibody (H00005087-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PBX1 Antibody (H00005087-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PBX1 Products

Bioinformatics Tool for PBX1 Antibody (H00005087-M01PCP)

Discover related pathways, diseases and genes to PBX1 Antibody (H00005087-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBX1 Antibody (H00005087-M01PCP)

Discover more about diseases related to PBX1 Antibody (H00005087-M01PCP).
 

Pathways for PBX1 Antibody (H00005087-M01PCP)

View related products by pathway.

PTMs for PBX1 Antibody (H00005087-M01PCP)

Learn more about PTMs related to PBX1 Antibody (H00005087-M01PCP).

Blogs on PBX1

There are no specific blogs for PBX1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBX1 Antibody (4A2) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PBX1