PBEF/Visfatin/NAMPT Antibody


Western Blot: PBEF/Visfatin/NAMPT Antibody [NBP1-52877] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: PBEF/Visfatin/NAMPT Antibody [NBP1-52877] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more
Western Blot: PBEF/Visfatin/NAMPT Antibody [NBP1-52877] - Reccomended Titration: 1.25 ug/ml Positive Control: Jurkat cell lysate

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PBEF/Visfatin/NAMPT Antibody Summary

Synthetic peptides corresponding to PBEF1(pre-B-cell colony enhancing factor 1) The peptide sequence was selected from the C terminal of PBEF1 (NP_005737). Peptide sequence VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publications using
NBP1-52877 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PBEF/Visfatin/NAMPT Antibody

  • EC
  • MGC117256
  • NAmPRTase
  • nicotinamide phosphoribosyltransferase
  • NMPRTase
  • PBEF
  • PBEF1
  • PBEF1110035O14Rik
  • PBEF1DKFZp666B131
  • Pre-B cell-enhancing factor
  • pre-B-cell colony enhancing factor 1
  • Pre-B-cell colony-enhancing factor 1
  • VF
  • Visfatin


PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PBEF/Visfatin/NAMPT Antibody (NBP1-52877)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for PBEF/Visfatin/NAMPT Antibody (NBP1-52877) (0)

There are no reviews for PBEF/Visfatin/NAMPT Antibody (NBP1-52877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBEF/Visfatin/NAMPT Antibody (NBP1-52877) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PBEF/Visfatin/NAMPT Antibody (NBP1-52877)

Discover related pathways, diseases and genes to PBEF/Visfatin/NAMPT Antibody (NBP1-52877). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBEF/Visfatin/NAMPT Antibody (NBP1-52877)

Discover more about diseases related to PBEF/Visfatin/NAMPT Antibody (NBP1-52877).

Pathways for PBEF/Visfatin/NAMPT Antibody (NBP1-52877)

View related products by pathway.

PTMs for PBEF/Visfatin/NAMPT Antibody (NBP1-52877)

Learn more about PTMs related to PBEF/Visfatin/NAMPT Antibody (NBP1-52877).

Research Areas for PBEF/Visfatin/NAMPT Antibody (NBP1-52877)

Find related products by research area.

Blogs on PBEF/Visfatin/NAMPT

There are no specific blogs for PBEF/Visfatin/NAMPT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PBEF/Visfatin/NAMPT Antibody and receive a gift card or discount.


Gene Symbol NAMPT