PBEF/Visfatin/NAMPT Antibody

Images

 
Western Blot: NAMPT Antibody [NBP1-52874] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.
Western Blot: NAMPT Antibody [NBP1-52874] - Jurkat cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Product Discontinued
View other related PBEF/Visfatin/NAMPT Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52874
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PBEF/Visfatin/NAMPT Antibody Summary

Immunogen
Synthetic peptides corresponding to PBEF1(pre-B-cell colony enhancing factor 1) The peptide sequence was selected from the C terminal of PBEF1. Peptide sequence CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL.
Clonality
Polyclonal
Host
Rabbit
Gene
NAMPT
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PBEF1 and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PBEF/Visfatin/NAMPT Antibody

  • EC 2.4.2.12
  • MGC117256
  • NAmPRTase
  • NAMPT
  • nicotinamide phosphoribosyltransferase
  • NMPRTase
  • PBEF
  • PBEF1
  • PBEF1110035O14Rik
  • PBEF1DKFZp666B131
  • Pre-B cell-enhancing factor
  • pre-B-cell colony enhancing factor 1
  • Pre-B-cell colony-enhancing factor 1
  • VF
  • Visfatin

Background

PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-31176
Species: Hu
Applications: WB, ELISA, IHC
AF5347
Species: Rt
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52874
Species: Hu
Applications: WB

Publications for PBEF/Visfatin/NAMPT Antibody (NBP1-52874) (0)

There are no publications for PBEF/Visfatin/NAMPT Antibody (NBP1-52874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PBEF/Visfatin/NAMPT Antibody (NBP1-52874) (0)

There are no reviews for PBEF/Visfatin/NAMPT Antibody (NBP1-52874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PBEF/Visfatin/NAMPT Antibody (NBP1-52874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PBEF/Visfatin/NAMPT Products

Bioinformatics Tool for PBEF/Visfatin/NAMPT Antibody (NBP1-52874)

Discover related pathways, diseases and genes to PBEF/Visfatin/NAMPT Antibody (NBP1-52874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBEF/Visfatin/NAMPT Antibody (NBP1-52874)

Discover more about diseases related to PBEF/Visfatin/NAMPT Antibody (NBP1-52874).
 

Pathways for PBEF/Visfatin/NAMPT Antibody (NBP1-52874)

View related products by pathway.

PTMs for PBEF/Visfatin/NAMPT Antibody (NBP1-52874)

Learn more about PTMs related to PBEF/Visfatin/NAMPT Antibody (NBP1-52874).
 

Research Areas for PBEF/Visfatin/NAMPT Antibody (NBP1-52874)

Find related products by research area.

Blogs on PBEF/Visfatin/NAMPT

There are no specific blogs for PBEF/Visfatin/NAMPT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBEF/Visfatin/NAMPT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAMPT
Entrez
Uniprot