PAX8 Antibody (3G11)


Western Blot: PAX8 Antibody (3G11) [H00007849-M10] - Analysis of PAX8 expression in human ovarian cancer.
Western Blot: PAX8 Antibody (3G11) [H00007849-M10] - Analysis of PAX8 expression in human parotid gland.
ELISA: PAX8 Antibody (3G11) [H00007849-M10] - Detection limit for recombinant GST tagged PAX8 is approximately 1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

PAX8 Antibody (3G11) Summary

PAX8 (NP_003457, 300 a.a. - 377 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH
PAX8 - paired box gene 8
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAX8 Antibody (3G11)

  • paired box 8
  • paired box gene 8
  • paired box protein Pax-8
  • paired domain gene 8


This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternateively spliced transcript variants encoding different isoforms have been described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC

Publications for PAX8 Antibody (H00007849-M10) (0)

There are no publications for PAX8 Antibody (H00007849-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAX8 Antibody (H00007849-M10) (0)

There are no reviews for PAX8 Antibody (H00007849-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAX8 Antibody (H00007849-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PAX8 Products

Bioinformatics Tool for PAX8 Antibody (H00007849-M10)

Discover related pathways, diseases and genes to PAX8 Antibody (H00007849-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAX8 Antibody (H00007849-M10)

Discover more about diseases related to PAX8 Antibody (H00007849-M10).

Pathways for PAX8 Antibody (H00007849-M10)

View related products by pathway.

PTMs for PAX8 Antibody (H00007849-M10)

Learn more about PTMs related to PAX8 Antibody (H00007849-M10).

Research Areas for PAX8 Antibody (H00007849-M10)

Find related products by research area.

Blogs on PAX8

There are no specific blogs for PAX8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAX8 Antibody (3G11) and receive a gift card or discount.


Gene Symbol PAX8