Pax7 Antibody

Images

 
Western Blot: Pax7 Antibody [NBP1-69130] - Titration: 0.2-1 ug/ml, Positive Control: Rat Muscle.
Immunocytochemistry/ Immunofluorescence: Pax7 Antibody [NBP1-69130] - Overexpression of Pax7 in C2C12 cells, Dilution: 1:100
Immunocytochemistry/ Immunofluorescence: Pax7 Antibody [NBP1-69130] - C2C12 cells 1:100

Product Details

Summary
Product Discontinued
View other related Pax7 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69130
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Pax7 Antibody Summary

Immunogen
Synthetic peptides corresponding to Pax7 (paired box 7) The peptide sequence was selected from the middle region of Pax7. Peptide sequence SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ.
Clonality
Polyclonal
Host
Rabbit
Gene
PAX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:100
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Concentration
LYOPH
Purity
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Pax7 Antibody

  • FLJ37460
  • HUP1
  • paired box 7
  • paired box gene 7
  • paired box homeotic gene 7
  • paired box protein Pax-7
  • paired domain gene 7
  • PAX7 transcriptional factor
  • Pax7
  • PAX7B
  • RMS2

Background

The function of Pax7 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31216
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-69130
Species: Mu, Rt
Applications: WB, ICC/IF

Publications for Pax7 Antibody (NBP1-69130) (0)

There are no publications for Pax7 Antibody (NBP1-69130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax7 Antibody (NBP1-69130) (0)

There are no reviews for Pax7 Antibody (NBP1-69130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pax7 Antibody (NBP1-69130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pax7 Products

Bioinformatics Tool for Pax7 Antibody (NBP1-69130)

Discover related pathways, diseases and genes to Pax7 Antibody (NBP1-69130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax7 Antibody (NBP1-69130)

Discover more about diseases related to Pax7 Antibody (NBP1-69130).
 

Pathways for Pax7 Antibody (NBP1-69130)

View related products by pathway.

PTMs for Pax7 Antibody (NBP1-69130)

Learn more about PTMs related to Pax7 Antibody (NBP1-69130).

Blogs on Pax7

There are no specific blogs for Pax7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX7
Entrez