Pax2 Antibody

Images

 
Western Blot: Pax2 Antibody [NBP1-69177] - Mouse Small Intestine, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Pax2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69177
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Pax2 Antibody Summary

Immunogen
Synthetic peptides corresponding to Pax2 (paired box gene 2) The peptide sequence was selected from the middle region of Pax2. Peptide sequence HIKSEQGNEYSLPALTPGLDEVKSSLSASANPELGSNVSGTQTYPVVTGR.
Clonality
Polyclonal
Host
Rabbit
Gene
PAX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Pax2 and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Pax2 Antibody

  • paired box 2
  • paired box gene 2
  • paired box homeotic gene 2
  • paired box protein Pax-2
  • Pax2

Background

The function of Pax2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

423-F8/CF
Species: Hu, Mu
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-32440
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
AF3487
Species: Hu
Applications: WB, IHC, ICC
AF1620
Species: Mu
Applications: WB, IHC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01926
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
AF482
Species: Mu
Applications: WB, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
AF475
Species: Mu
Applications: WB, IHC
NBP2-58069
Species: Hu
Applications: ICC/IF
NBP1-69177
Species: Mu
Applications: WB

Publications for Pax2 Antibody (NBP1-69177) (0)

There are no publications for Pax2 Antibody (NBP1-69177).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax2 Antibody (NBP1-69177) (0)

There are no reviews for Pax2 Antibody (NBP1-69177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pax2 Antibody (NBP1-69177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pax2 Products

Bioinformatics Tool for Pax2 Antibody (NBP1-69177)

Discover related pathways, diseases and genes to Pax2 Antibody (NBP1-69177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax2 Antibody (NBP1-69177)

Discover more about diseases related to Pax2 Antibody (NBP1-69177).
 

Pathways for Pax2 Antibody (NBP1-69177)

View related products by pathway.

PTMs for Pax2 Antibody (NBP1-69177)

Learn more about PTMs related to Pax2 Antibody (NBP1-69177).

Blogs on Pax2

There are no specific blogs for Pax2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX2
Entrez