Patched 1/PTCH Antibody (3C2)

Images

 
ELISA: Patched 1/PTCH Antibody (3C2) [H00005727-M08] - Detection limit for recombinant GST tagged PTCH is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related Patched 1/PTCH Primary Antibodies

Order Details


    • Catalog Number
      H00005727-M08
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Patched 1/PTCH Antibody (3C2) Summary

Immunogen
PTCH (NP_000255 841 a.a. - 940 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN
Specificity
PTCH - patched homolog (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTCH1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Patched 1/PTCH Antibody (3C2)

  • BCNS
  • BCNSFLJ42602
  • FLJ26746
  • HPE7
  • mes
  • NBCCS
  • patched (Drosophila) homolog
  • Patched 1
  • patched homolog (Drosophila)
  • patched homolog 1 (Drosophila)
  • patched homolog 1
  • protein patched homolog 1
  • PTC
  • ptc1
  • PTCH protein +12b
  • PTCH protein +4'
  • PTCH protein -10
  • PTCH
  • PTCH1
  • PTCH11

Background

This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
1705-HH/CF
Species: Hu, Mu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF4078
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC

Publications for Patched 1/PTCH Antibody (H00005727-M08) (0)

There are no publications for Patched 1/PTCH Antibody (H00005727-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Patched 1/PTCH Antibody (H00005727-M08) (0)

There are no reviews for Patched 1/PTCH Antibody (H00005727-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Patched 1/PTCH Antibody (H00005727-M08). (Showing 1 - 1 of 1 FAQ).

  1. I need a proven anti-human Ptch1 antibody that maps C-terminus of Ptch1 protein which is thus appropriate for all isoforms of human Ptch1 protein. Can you please suggest any which can be used for Western blotting?
    • NB100-41101 is expected to recognize all isoforms. NBP2-19705, NBP1-71662, 21130002, and NBP1-59455 should all suit your needs as well. Further details about each product can be found on their individual datasheets.

Secondary Antibodies

 

Isotype Controls

Additional Patched 1/PTCH Products

Bioinformatics Tool for Patched 1/PTCH Antibody (H00005727-M08)

Discover related pathways, diseases and genes to Patched 1/PTCH Antibody (H00005727-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Patched 1/PTCH Antibody (H00005727-M08)

Discover more about diseases related to Patched 1/PTCH Antibody (H00005727-M08).
 

Pathways for Patched 1/PTCH Antibody (H00005727-M08)

View related products by pathway.

PTMs for Patched 1/PTCH Antibody (H00005727-M08)

Learn more about PTMs related to Patched 1/PTCH Antibody (H00005727-M08).
 

Research Areas for Patched 1/PTCH Antibody (H00005727-M08)

Find related products by research area.

Blogs on Patched 1/PTCH

There are no specific blogs for Patched 1/PTCH, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Patched 1/PTCH Antibody (3C2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCH1
Entrez
OMIM
Uniprot