Parvin gamma Antibody

Images

 
Western Blot: Parvin gamma Antibody [H00064098-D01P] - Analysis of PARVG expression in human spleen.
Western Blot: Parvin gamma Antibody [H00064098-D01P] - Analysis of PARVG expression in transfected 293T cell line by PARVG polyclonal antibody.Lane 1: PARVG transfected lysate(37.50 KDa).Lane 2: Non-transfected lysate.
Immunoprecipitation: Parvin gamma Antibody [H00064098-D01P] - Analysis of PARVG transfected lysate using anti-PARVG rabbit polyclonal antibody and Protein Magnetic Bead, and immunoblotted with PARVG purified mouse ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Parvin gamma Antibody Summary

Immunogen
PARVG (NP_071424.1, 1 a.a. - 331 a.a.) full-length human protein. MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
Specificity
PARVG - parvin, gamma,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARVG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunoprecipitation
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00064098-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Parvin gamma Antibody

  • gamma-parvin
  • parvin, gamma

Background

Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46326
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P, IF
NBP2-46327
Species: Hu
Applications: WB, IHC
NBP2-37448
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-24459
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB847
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
NBP1-89124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-85889
Species: Hu
Applications: WB
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-81867
Species: Hu
Applications: IHC, IHC-P
NBP2-57757
Species: Hu
Applications: IHC, IHC-P
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47404
Species: Hu
Applications: IHC, IHC-P
NBP1-32682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00064098-D01P
Species: Hu
Applications: WB, IP

Publications for Parvin gamma Antibody (H00064098-D01P)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Parvin gamma Antibody (H00064098-D01P) (0)

There are no reviews for Parvin gamma Antibody (H00064098-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Parvin gamma Antibody (H00064098-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Parvin gamma Products

Bioinformatics Tool for Parvin gamma Antibody (H00064098-D01P)

Discover related pathways, diseases and genes to Parvin gamma Antibody (H00064098-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Parvin gamma Antibody (H00064098-D01P)

Discover more about diseases related to Parvin gamma Antibody (H00064098-D01P).
 

Pathways for Parvin gamma Antibody (H00064098-D01P)

View related products by pathway.

PTMs for Parvin gamma Antibody (H00064098-D01P)

Learn more about PTMs related to Parvin gamma Antibody (H00064098-D01P).

Blogs on Parvin gamma

There are no specific blogs for Parvin gamma, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Parvin gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARVG
Entrez
Uniprot