PARP15 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PARP15 Antibody [NBP2-58821] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARP15 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTCNLPEHWTDMNHQLFCMVQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARP15
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PARP15 Antibody

  • B-aggressive lymphoma 3
  • B-aggressive lymphoma protein 3
  • BAL3MGC126752
  • EC 2.4.2.30
  • FLJ40196
  • FLJ40597
  • MGC126750
  • PARP-15
  • pART7
  • poly (ADP-ribose) polymerase family, member 15
  • poly [ADP-ribose] polymerase 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-186
Species: Hu
Applications: WB, ICC/IF
NBP2-20940
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-56436
Species: Hu
Applications: WB, IHC
NBP1-93592
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for PARP15 Antibody (NBP2-58821) (0)

There are no publications for PARP15 Antibody (NBP2-58821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP15 Antibody (NBP2-58821) (0)

There are no reviews for PARP15 Antibody (NBP2-58821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PARP15 Antibody (NBP2-58821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARP15 Products

PARP15 NBP2-58821

Bioinformatics Tool for PARP15 Antibody (NBP2-58821)

Discover related pathways, diseases and genes to PARP15 Antibody (NBP2-58821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP15 Antibody (NBP2-58821)

Discover more about diseases related to PARP15 Antibody (NBP2-58821).
 

Pathways for PARP15 Antibody (NBP2-58821)

View related products by pathway.

Research Areas for PARP15 Antibody (NBP2-58821)

Find related products by research area.

Blogs on PARP15

There are no specific blogs for PARP15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP15