PARP11 Antibody

Images

 
Western Blot: PARP11 Antibody [NBP1-52990] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PARP11 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52990
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PARP11 Antibody Summary

Immunogen
Synthetic peptides corresponding to PARP11(poly (ADP-ribose) polymerase family, member 11) The peptide sequence was selected from the middle region of PARP11. Peptide sequence IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD.
Clonality
Polyclonal
Host
Rabbit
Gene
PARP11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PARP11 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PARP11 Antibody

  • C12orf6
  • chromosome 12 open reading frame 6
  • DKFZp779H0122
  • EC 2.4.2.30
  • MIB006
  • PARP-11
  • poly (ADP-ribose) polymerase family, member 11
  • poly [ADP-ribose] polymerase 11

Background

PARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. PARP1 can be cleaved resulting in fragements of 29 and 85 kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-93592
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
2629-FG/CF
Species: Mu
NBP2-43728
Species: Hu
Applications: WB, ICC/IF

Publications for PARP11 Antibody (NBP1-52990) (0)

There are no publications for PARP11 Antibody (NBP1-52990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARP11 Antibody (NBP1-52990) (0)

There are no reviews for PARP11 Antibody (NBP1-52990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARP11 Antibody (NBP1-52990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARP11 Products

Bioinformatics Tool for PARP11 Antibody (NBP1-52990)

Discover related pathways, diseases and genes to PARP11 Antibody (NBP1-52990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARP11 Antibody (NBP1-52990)

Discover more about diseases related to PARP11 Antibody (NBP1-52990).

Research Areas for PARP11 Antibody (NBP1-52990)

Find related products by research area.

Blogs on PARP11

There are no specific blogs for PARP11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARP11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARP11
Uniprot