PARD6B Antibody (1C4) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related PARD6B Primary Antibodies

Order Details


    • Catalog Number
      H00084612-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PARD6B Antibody (1C4) [DyLight 405] Summary

Immunogen
PARD6B (AAH60847, 1 a.a. ~ 373 a.a) full length recombinant protein with GST tag.MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEE FYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAVST ANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHR KKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKP LGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLA VNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIIT
Specificity
PARD6B - par-6 partitioning defective 6 homolog beta (C. elegans)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PARD6B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PARD6B Antibody (1C4) [DyLight 405]

  • par-6 (partitioning defective 6, C.elegans) homolog beta
  • PAR-6 beta
  • par-6 partitioning defective 6 homolog beta (C. elegans)
  • PAR6B
  • PAR-6B
  • partitioning defective 6 homolog beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-85046
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
H00008856-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-30757
Species: Hu
Applications: IHC, IHC-P
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
AF1013
Species: Mu
Applications: WB, IHC, IP
NBP1-81838
Species: Hu
Applications: WB, IHC, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF1213
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-82147
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PARD6B Antibody (H00084612-M01V) (0)

There are no publications for PARD6B Antibody (H00084612-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARD6B Antibody (H00084612-M01V) (0)

There are no reviews for PARD6B Antibody (H00084612-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PARD6B Antibody (H00084612-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARD6B Antibody (1C4) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for PARD6B Antibody (H00084612-M01V)

Discover related pathways, diseases and genes to PARD6B Antibody (H00084612-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD6B Antibody (H00084612-M01V)

Discover more about diseases related to PARD6B Antibody (H00084612-M01V).
 

Pathways for PARD6B Antibody (H00084612-M01V)

View related products by pathway.

PTMs for PARD6B Antibody (H00084612-M01V)

Learn more about PTMs related to PARD6B Antibody (H00084612-M01V).
 

Research Areas for PARD6B Antibody (H00084612-M01V)

Find related products by research area.

Blogs on PARD6B

There are no specific blogs for PARD6B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARD6B Antibody (1C4) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol PARD6B