Recombinant Human Pappalysin-1/PAPP-A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Pappalysin-1/PAPP-A Protein Summary

Description
Pappalysin-1/PAPP-A (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
PAPPA

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pappalysin-1/PAPP-A Protein

  • ASBABP2
  • DIPLA1
  • EC 3.4.24.79
  • IGFBP-4ase
  • IGFBP-4aseaspecific BCL2 ARE-binding protein 2
  • IGF-dependent IGFBP-4 protease
  • insulin-like growth factor-dependent IGF binding protein-4 protease
  • Insulin-like growth factor-dependent IGF-binding protein 4 protease
  • PAPA
  • PAPPA
  • PAPPA1
  • PAPP-A1
  • PAPP-Adifferentially placenta 1 expressed protein
  • Pappalysin1
  • Pappalysin-1
  • pregnacy-associated plasma protein A
  • Pregnancy-associated plasma protein A
  • pregnancy-associated plasma protein A, pappalysin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80549
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF875
Species: Hu
Applications: WB, IHC
NBP2-46376
Species: Hu
Applications: WB, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01) (0)

There are no publications for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01) (0)

There are no reviews for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am highly interested to use couple of Anti-PAPP-A antibodies from your reputed companies for my research work. I have got the information regarding the immunogen used to generate these antibodies, however could not get any information regarding the specific amino acids/epitope to which your Anti-PAPP-A Antibodies binds with the antigen (PAPP-A).
    • Unfortunately, none of our PAPP A antibodies have been epitope mapped. Many of them have also been generated against full-length PAPP A, so there are many potential binding sites.

Additional Pappalysin-1/PAPP-A Products

Related Products by Gene

Bioinformatics Tool for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01)

Discover related pathways, diseases and genes to Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01)

Discover more about diseases related to Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01).
 

Pathways for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01)

View related products by pathway.

PTMs for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01)

Learn more about PTMs related to Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01).
 

Research Areas for Pappalysin-1/PAPP-A Partial Recombinant Protein (H00005069-Q01)

Find related products by research area.

Blogs on Pappalysin-1/PAPP-A

There are no specific blogs for Pappalysin-1/PAPP-A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pappalysin-1/PAPP-A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAPPA
Entrez
Uniprot

Customers Who Bought This Also Bought