Pappalysin-1/PAPP-A Antibody (1G3)

Images

 
There are currently no images for Pappalysin-1/PAPP-A Antibody (H00005069-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pappalysin-1/PAPP-A Antibody (1G3) Summary

Immunogen
PAPPA (NP_002572 85 a.a. - 194 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG
Specificity
PAPPA (1G3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAPPA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pappalysin-1/PAPP-A Antibody (1G3)

  • ASBABP2
  • DIPLA1
  • EC 3.4.24.79
  • IGFBP-4ase
  • IGFBP-4aseaspecific BCL2 ARE-binding protein 2
  • IGF-dependent IGFBP-4 protease
  • insulin-like growth factor-dependent IGF binding protein-4 protease
  • Insulin-like growth factor-dependent IGF-binding protein 4 protease
  • PAPA
  • PAPPA
  • PAPPA1
  • PAPP-A1
  • PAPP-Adifferentially placenta 1 expressed protein
  • Pappalysin1
  • Pappalysin-1
  • pregnacy-associated plasma protein A
  • Pregnancy-associated plasma protein A
  • pregnancy-associated plasma protein A, pappalysin 1

Background

This gene encodes a secreted metalloproteinase which cleaves insulin-like growth factor binding proteins (IGFBPs). It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80549
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PAGE
AF875
Species: Hu
Applications: WB, IHC
NBP2-46376
Species: Hu
Applications: WB, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
H00005069-M01
Species: Hu
Applications: WB, ELISA

Publications for Pappalysin-1/PAPP-A Antibody (H00005069-M01) (0)

There are no publications for Pappalysin-1/PAPP-A Antibody (H00005069-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pappalysin-1/PAPP-A Antibody (H00005069-M01) (0)

There are no reviews for Pappalysin-1/PAPP-A Antibody (H00005069-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pappalysin-1/PAPP-A Antibody (H00005069-M01). (Showing 1 - 1 of 1 FAQ).

  1. I am highly interested to use couple of Anti-PAPP-A antibodies from your reputed companies for my research work. I have got the information regarding the immunogen used to generate these antibodies, however could not get any information regarding the specific amino acids/epitope to which your Anti-PAPP-A Antibodies binds with the antigen (PAPP-A).
    • Unfortunately, none of our PAPP A antibodies have been epitope mapped. Many of them have also been generated against full-length PAPP A, so there are many potential binding sites.

Secondary Antibodies

 

Isotype Controls

Additional Pappalysin-1/PAPP-A Products

Bioinformatics Tool for Pappalysin-1/PAPP-A Antibody (H00005069-M01)

Discover related pathways, diseases and genes to Pappalysin-1/PAPP-A Antibody (H00005069-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pappalysin-1/PAPP-A Antibody (H00005069-M01)

Discover more about diseases related to Pappalysin-1/PAPP-A Antibody (H00005069-M01).
 

Pathways for Pappalysin-1/PAPP-A Antibody (H00005069-M01)

View related products by pathway.

PTMs for Pappalysin-1/PAPP-A Antibody (H00005069-M01)

Learn more about PTMs related to Pappalysin-1/PAPP-A Antibody (H00005069-M01).
 

Research Areas for Pappalysin-1/PAPP-A Antibody (H00005069-M01)

Find related products by research area.

Blogs on Pappalysin-1/PAPP-A

There are no specific blogs for Pappalysin-1/PAPP-A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pappalysin-1/PAPP-A Antibody (1G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAPPA
Entrez
OMIM
Uniprot