PAPOLB Antibody (3D7) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related PAPOLB Primary Antibodies

Order Details


    • Catalog Number
      H00056903-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PAPOLB Antibody (3D7) [PE] Summary

Immunogen
PAPOLB (AAH36653, 1 a.a. ~ 638 a.a) full length recombinant protein with GST tag.MMPFPVTTQGPPQPAPPPNRYGVSSPISLAVPKETDCLLTQR LIETLRPFGVFEEEEELQRRILVLDKLNNLVKEWIREISESK SLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPSHVD RSDFFTSFYAKLKLQEEVKDLRAVQEAFVPVIKLCFDGIEID ILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDE ILHLVPNIDNFRLTLRAIKLWAKCHNIYSNILGFL
Specificity
PAPOLB - poly(A) polymerase beta (testis specific)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAPOLB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PAPOLB Antibody (3D7) [PE]

  • EC 2.7.7
  • EC 2.7.7.19
  • PAP-beta
  • PAPTTPAP
  • poly(A) polymerase beta (testis specific)
  • poly(A) polymerase beta
  • Polynucleotide adenylyltransferase beta
  • Testis-specific poly(A) polymerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-55268
Species: Hu
Applications: WB, IP
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-80726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56435
Species: Hu, Mu
Applications: WB
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for PAPOLB Antibody (H00056903-M01PE) (0)

There are no publications for PAPOLB Antibody (H00056903-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAPOLB Antibody (H00056903-M01PE) (0)

There are no reviews for PAPOLB Antibody (H00056903-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PAPOLB Antibody (H00056903-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAPOLB Products

Bioinformatics Tool for PAPOLB Antibody (H00056903-M01PE)

Discover related pathways, diseases and genes to PAPOLB Antibody (H00056903-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PAPOLB

There are no specific blogs for PAPOLB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAPOLB Antibody (3D7) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol PAPOLB