Paladin Antibody

Images

 
Western Blot: Paladin Antibody [NBP2-85438] - Host: Rabbit. Target Name: PALD1. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Bv, EqSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Paladin Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Paladin. Peptide sequence: FRRVLQKLQKDGHRECVIFCVREEPVLFLRADEDFVSYTPRDKQNLHENL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Bovine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
PALD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Paladin Antibody

  • KIAA1274
  • paladin
  • PALD
  • palladin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-38361
Species: Hu
Applications: IHC, IHC-P
NBP2-00555
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38924
Species: Hu
Applications: IHC, IHC-P
NBP1-25959
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KD
NBP2-52977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84443
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45552
Species: Hu
Applications: WB, IHC
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06067
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP3-09537
Species: Hu
Applications: WB
NBP2-45626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27300
Species: Hu
Applications: WB, IHC, IHC-P
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP3-09512
Species: Hu
Applications: WB
NBP2-85438
Species: Hu, Bv, Eq
Applications: WB

Publications for Paladin Antibody (NBP2-85438) (0)

There are no publications for Paladin Antibody (NBP2-85438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Paladin Antibody (NBP2-85438) (0)

There are no reviews for Paladin Antibody (NBP2-85438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Paladin Antibody (NBP2-85438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Paladin Products

Bioinformatics Tool for Paladin Antibody (NBP2-85438)

Discover related pathways, diseases and genes to Paladin Antibody (NBP2-85438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Paladin Antibody (NBP2-85438)

Find related products by research area.

Blogs on Paladin

There are no specific blogs for Paladin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Paladin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PALD1