PAK5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PAK5 Antibody [NBP1-89609] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PAK5 Antibody [NBP1-89609] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAK5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAK7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PAK5 Protein (NBP1-89609PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PAK5 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1264MGC26232
  • p21 protein (Cdc42/Rac)-activated kinase 7
  • p21(CDKN1A)-activated kinase 7
  • p21-activated kinase 5
  • p21-activated kinase 7
  • PAK-5
  • PAK5p21CDKN1A-activated kinase 7
  • PAK-7
  • protein kinase PAK5
  • serine/threonine-protein kinase PAK 7
  • serine/threonine-protein kinase PAK7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46316
Species: Hu
Applications: WB, IHC
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4265
Species: Hu, Mu, Rt
Applications: WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89609
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PAK5 Antibody (NBP1-89609) (0)

There are no publications for PAK5 Antibody (NBP1-89609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAK5 Antibody (NBP1-89609) (0)

There are no reviews for PAK5 Antibody (NBP1-89609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PAK5 Antibody (NBP1-89609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PAK5 Products

Bioinformatics Tool for PAK5 Antibody (NBP1-89609)

Discover related pathways, diseases and genes to PAK5 Antibody (NBP1-89609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAK5 Antibody (NBP1-89609)

Discover more about diseases related to PAK5 Antibody (NBP1-89609).
 

Pathways for PAK5 Antibody (NBP1-89609)

View related products by pathway.

PTMs for PAK5 Antibody (NBP1-89609)

Learn more about PTMs related to PAK5 Antibody (NBP1-89609).
 

Research Areas for PAK5 Antibody (NBP1-89609)

Find related products by research area.

Blogs on PAK5

There are no specific blogs for PAK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAK5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAK7