Recombinant Human PACT Protein

Images

 

Product Details

Summary
Product Discontinued
View other related PACT Peptides and Proteins

Order Details


    • Catalog Number
      H00008575-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human PACT Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 101-200 of Human PRKRA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRKRA

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PACT Protein

  • DYT16
  • DYT16interferon-inducible double stranded RNA-dependent activator
  • HSD14
  • PACT
  • PACTPKR-associating protein X
  • PKR-associated protein X
  • PKR-Associating Protein X
  • PRKRA
  • protein kinase, interferon-inducible double stranded RNA dependent activator
  • RAX
  • RAXHSD14

Background

PRKRA - protein kinase, interferon-inducible double stranded RNA dependent activator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-56137
Species: Hu
Applications: ICC/IF
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-49535
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00055145-D01P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, GP, Pm, Rb, Sh
Applications: WB, Simple Western, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
H00008575-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PACT Partial Recombinant Protein (H00008575-Q01) (0)

There are no publications for PACT Partial Recombinant Protein (H00008575-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACT Partial Recombinant Protein (H00008575-Q01) (0)

There are no reviews for PACT Partial Recombinant Protein (H00008575-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PACT Partial Recombinant Protein (H00008575-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PACT Products

Bioinformatics Tool for PACT Partial Recombinant Protein (H00008575-Q01)

Discover related pathways, diseases and genes to PACT Partial Recombinant Protein (H00008575-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACT Partial Recombinant Protein (H00008575-Q01)

Discover more about diseases related to PACT Partial Recombinant Protein (H00008575-Q01).
 

Pathways for PACT Partial Recombinant Protein (H00008575-Q01)

View related products by pathway.

PTMs for PACT Partial Recombinant Protein (H00008575-Q01)

Learn more about PTMs related to PACT Partial Recombinant Protein (H00008575-Q01).
 

Research Areas for PACT Partial Recombinant Protein (H00008575-Q01)

Find related products by research area.

Blogs on PACT

There are no specific blogs for PACT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PACT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRA
Entrez