PACT Antibody

Images

 
Independent Antibodies: Western Blot: PACT Antibody [NBP2-55124] - Analysis using Anti-PRKRA antibody NBP2-55124 (A) shows similar pattern to independent antibody NBP2-55123 (B).
Immunocytochemistry/ Immunofluorescence: PACT Antibody [NBP2-55124] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PACT Antibody [NBP2-55124] - Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
Genetic Strategies: Western Blot: PACT Antibody [NBP2-55124] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PACT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGK
Specificity
Specificity of human PACT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKRA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PACT Knockout 293T Cell Lysate
Control Peptide
PACT Recombinant Protein Antigen (NBP2-55124PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PACT Antibody

  • DYT16
  • DYT16interferon-inducible double stranded RNA-dependent activator
  • HSD14
  • PACT
  • PACTPKR-associating protein X
  • PKR-associated protein X
  • PKR-Associating Protein X
  • PRKRA
  • protein kinase, interferon-inducible double stranded RNA dependent activator
  • RAX
  • RAXHSD14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC, IHC-P
NBP3-03780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-71691
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49535
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-93163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, B/N
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO

Publications for PACT Antibody (NBP2-55124) (0)

There are no publications for PACT Antibody (NBP2-55124).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACT Antibody (NBP2-55124) (0)

There are no reviews for PACT Antibody (NBP2-55124). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PACT Antibody (NBP2-55124) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PACT Products

Bioinformatics Tool for PACT Antibody (NBP2-55124)

Discover related pathways, diseases and genes to PACT Antibody (NBP2-55124). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACT Antibody (NBP2-55124)

Discover more about diseases related to PACT Antibody (NBP2-55124).
 

Pathways for PACT Antibody (NBP2-55124)

View related products by pathway.

PTMs for PACT Antibody (NBP2-55124)

Learn more about PTMs related to PACT Antibody (NBP2-55124).
 

Research Areas for PACT Antibody (NBP2-55124)

Find related products by research area.

Blogs on PACT

There are no specific blogs for PACT, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PACT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRA