PACT Antibody

Images

 
Western Blot: PACT Antibody [NBP1-58962] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related PACT Primary Antibodies

Order Details


    • Catalog Number
      NBP1-58962
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PACT Antibody Summary

Immunogen
Synthetic peptides corresponding to PRKRA(protein kinase, interferon-inducible double stranded RNA dependent activator) The peptide sequence was selected from the N terminal of PRKRA. Peptide sequence MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKRA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PRKRA and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PACT Antibody

  • DYT16
  • DYT16interferon-inducible double stranded RNA-dependent activator
  • HSD14
  • PACT
  • PACTPKR-associating protein X
  • PKR-associated protein X
  • PKR-Associating Protein X
  • PRKRA
  • protein kinase, interferon-inducible double stranded RNA dependent activator
  • RAX
  • RAXHSD14

Background

PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-56137
Species: Hu
Applications: ICC/IF
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-49535
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00055145-D01P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB300-750
Species: Hu, Mu, Rt, Fi, Mk, Pm, Sh
Applications: WB, ICC/IF, IHC, IP, ICC
NBP1-59794
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NB300-540
Species: Hu, Mu, Rt, Bv, Ca, GP, Pm, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, B/N
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84476
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl, IHC-WhMt
NBP1-58962
Species: Hu, Mu, Rt, Po, Bv, Ca, GP, Rb
Applications: WB

Publications for PACT Antibody (NBP1-58962) (0)

There are no publications for PACT Antibody (NBP1-58962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PACT Antibody (NBP1-58962) (0)

There are no reviews for PACT Antibody (NBP1-58962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PACT Antibody (NBP1-58962). (Showing 1 - 1 of 1 FAQ).

  1. Which band is PACT?
    • The approximate 34kDa band you see on the Western blot image for NBP1-58962 is PACT.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PACT Products

Bioinformatics Tool for PACT Antibody (NBP1-58962)

Discover related pathways, diseases and genes to PACT Antibody (NBP1-58962). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PACT Antibody (NBP1-58962)

Discover more about diseases related to PACT Antibody (NBP1-58962).
 

Pathways for PACT Antibody (NBP1-58962)

View related products by pathway.

PTMs for PACT Antibody (NBP1-58962)

Learn more about PTMs related to PACT Antibody (NBP1-58962).
 

Research Areas for PACT Antibody (NBP1-58962)

Find related products by research area.

Blogs on PACT

There are no specific blogs for PACT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PACT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRA
Uniprot