PAC2 Antibody - BSA Free

Western Blot: PAC2 Antibody [NBP2-30576] - Analysis in control (vector only transfected HEK293T lysate) and PSMG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: PAC2 Antibody [NBP2-30576] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PAC2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PAC2 Protein (NBP2-30576PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PAC2 Antibody - BSA Free

• CLAST3HSPC260
• HCCA3PAC-2
• hepatocellular carcinoma susceptibility protein
• Hepatocellular carcinoma-susceptibility protein 3
• HsT1707
• likely ortholog of mouse CD40 ligand-activated specific transcript 3 (Clast3)
• MDS003
• MGC15092
• PAC2HDCMC29P
• proteasome (prosome, macropain) assembly chaperone 2
• proteasome assembling chaperone 2
• proteasome assembly chaperone 2
• TNFSF5IP1CD40 ligand-activated specific transcript 3
• Tumor necrosis factor superfamily member 5-induced protein 1
• tumor necrosis factor superfamily, member 5-induced protein 1
• x 003 protein

Background

Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMG2
• Uniprot:
  • Q969U7(Human)