PAC1R Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PAC1R Antibody [NBP2-68620] - Staining of human cell line SH-SY5Y shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAC1R Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADCYAP1R1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
PAC1R Recombinant Protein Antigen (NBP2-68620PEP)

Reactivity Notes

Mouse 87%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PAC1R Antibody

  • ADCYAP1R1
  • adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1
  • adenylate cyclase activating polypeptide 1 (pituitary) receptor type I
  • PAC1R
  • PACAP type I receptor
  • PACAPR
  • PACAP-R1
  • PACAP-R-1
  • PACAPRI
  • PACAPRPAC1
  • pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop
  • pituitary adenylate cyclase-activating polypeptide type I receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6380
Species: Mu
Applications: WB
NBP1-92287
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46349
Species: Hu
Applications: WB, IHC
MAB5416
Species: Hu
Applications: IHC
NBP1-47842
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-834
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2364
Species: Hu
Applications: WB, IHC
NBP2-68620
Species: Hu
Applications: ICC/IF

Publications for PAC1R Antibody (NBP2-68620) (0)

There are no publications for PAC1R Antibody (NBP2-68620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAC1R Antibody (NBP2-68620) (0)

There are no reviews for PAC1R Antibody (NBP2-68620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PAC1R Antibody (NBP2-68620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PAC1R Products

Array NBP2-68620

Bioinformatics Tool for PAC1R Antibody (NBP2-68620)

Discover related pathways, diseases and genes to PAC1R Antibody (NBP2-68620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAC1R Antibody (NBP2-68620)

Discover more about diseases related to PAC1R Antibody (NBP2-68620).
 

Pathways for PAC1R Antibody (NBP2-68620)

View related products by pathway.

PTMs for PAC1R Antibody (NBP2-68620)

Learn more about PTMs related to PAC1R Antibody (NBP2-68620).
 

Research Areas for PAC1R Antibody (NBP2-68620)

Find related products by research area.

Blogs on PAC1R

There are no specific blogs for PAC1R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAC1R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADCYAP1R1