PA28 Activator gamma Subunit/PSME3 Antibody


Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP1-54346] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PA28 Activator gamma Subunit/PSME3 Antibody Summary

Synthetic peptides corresponding to PSME3(proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)) The peptide sequence was selected from the C terminal of PSME3. Peptide sequence TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNA
This product is specific to Subunit or Isoform: 3.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PSME3 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
PA28 Activator gamma Subunit/PSME3 Lysate (NBP2-65720)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PA28 Activator gamma Subunit/PSME3 Antibody

  • 11S regulator complex gamma subunit
  • 11S regulator complex subunit gamma
  • Activator of multicatalytic protease subunit 3
  • Ki antigen
  • Ki
  • PA28 Activator gamma Subunit
  • PA28g
  • PA28gamma
  • PA28-gamma
  • PA28GKi nuclear autoantigen
  • proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
  • Proteasome activator 28 subunit gamma
  • proteasome activator 28-gamma
  • proteasome activator complex subunit 3
  • PSME3
  • REG gamma


The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring.The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Rt
Applications: WB, ELISA
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346) (0)

There are no publications for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346) (0)

There are no reviews for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional PA28 Activator gamma Subunit/PSME3 Products

Bioinformatics Tool for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346)

Discover related pathways, diseases and genes to PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346)

Discover more about diseases related to PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346).

Pathways for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346)

View related products by pathway.

PTMs for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346)

Learn more about PTMs related to PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346).

Research Areas for PA28 Activator gamma Subunit/PSME3 Antibody (NBP1-54346)

Find related products by research area.

Blogs on PA28 Activator gamma Subunit/PSME3

There are no specific blogs for PA28 Activator gamma Subunit/PSME3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PA28 Activator gamma Subunit/PSME3 Antibody and receive a gift card or discount.


Gene Symbol PSME3