p70 S6 Kinase/S6K Antibody

Images

 
Western Blot: p70 S6 Kinase/S6K Antibody [NBP1-55391] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: p70 S6 Kinase/S6K Antibody [NBP1-55391] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related p70 S6 Kinase/S6K Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55391
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

p70 S6 Kinase/S6K Antibody Summary

Immunogen
Synthetic peptides corresponding to RPS6KB1(ribosomal protein S6 kinase, 70kDa, polypeptide 1) The peptide sequence was selected from the N terminal of RPS6KB1 (NP_003152). Peptide sequence MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS6KB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RPS6KB1 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
p70 S6 Kinase/S6K Knockout HeLa Cell Lysate
Publications
Read Publication using NBP1-55391.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for p70 S6 Kinase/S6K Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • p70 ribosomal S6 kinase alpha
  • p70 S6 kinase alpha
  • p70 S6 Kinase
  • p70 S6 kinase, alpha 1,70 kDa ribosomal protein S6 kinase 1
  • p70 S6 kinase, alpha 2
  • p70 S6KA
  • p70 S6K-alpha
  • p70(S6K)-alpha
  • p70-alpha
  • p70-S6K
  • P70S6K1
  • PS6K
  • ribosomal protein S6 kinase beta-1
  • Ribosomal protein S6 kinase I
  • ribosomal protein S6 kinase, 70kD, polypeptide 1
  • ribosomal protein S6 kinase, 70kDa, polypeptide 1
  • RPS6KB1
  • S6K
  • S6K1
  • S6K1p70-S6K 1
  • S6K-beta-1
  • serine/threonine kinase 14 alpha
  • Serine/threonine-protein kinase 14A
  • STK14A

Background

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this prot

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46411
Species: Hu
Applications: WB, IHC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB79672
Species: Hu
Applications: WB, ICC/IF, ICC
NB100-82001
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for p70 S6 Kinase/S6K Antibody (NBP1-55391)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-55391 Applications Species
Ma,XM. Cell 133 (2), 303-313. 2008 [PMID: 18423201]

Reviews for p70 S6 Kinase/S6K Antibody (NBP1-55391) (0)

There are no reviews for p70 S6 Kinase/S6K Antibody (NBP1-55391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p70 S6 Kinase/S6K Antibody (NBP1-55391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional p70 S6 Kinase/S6K Products

Bioinformatics Tool for p70 S6 Kinase/S6K Antibody (NBP1-55391)

Discover related pathways, diseases and genes to p70 S6 Kinase/S6K Antibody (NBP1-55391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p70 S6 Kinase/S6K Antibody (NBP1-55391)

Discover more about diseases related to p70 S6 Kinase/S6K Antibody (NBP1-55391).
 

Pathways for p70 S6 Kinase/S6K Antibody (NBP1-55391)

View related products by pathway.

PTMs for p70 S6 Kinase/S6K Antibody (NBP1-55391)

Learn more about PTMs related to p70 S6 Kinase/S6K Antibody (NBP1-55391).
 

Research Areas for p70 S6 Kinase/S6K Antibody (NBP1-55391)

Find related products by research area.

Blogs on p70 S6 Kinase/S6K.

S6K - a serine/threonine kinase with diverse roles in cell survival and cell cycle progression
S6K is a serine/threonine kinase that is a member of the ribosomal S6 kinase (RSK) family. S6K exists in two main isoforms, S6K1 and S6K2, which can also be alternatively spliced to produce different splice forms. S6K1 has two major splicing produ...  Read full blog post.

Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p70 S6 Kinase/S6K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS6KB1
Entrez
Uniprot