p53R2 Antibody (6C1)

Immunocytochemistry/Immunofluorescence: p53R2 Antibody (6C1) [H00050484-M01] - Analysis of monoclonal antibody to RRM2B on HeLa cell . Antibody concentration 10 ug/ml.

Product Discontinued

p53R2 Antibody (6C1) Summary

• Immunogen: RRM2B (NP_056528, 3 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKAD
• Specificity: RRM2B - ribonucleotide reductase M2 B (TP53 inducible) (6C1)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RRM2B
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p53R2 Antibody (6C1)

• EC 1.17.4.1
• MGC102856
• MGC42116
• MTDPS8A
• MTDPS8B
• p53-inducible ribonucleotide reductase small subunit 2 homolog
• p53-inducible ribonucleotide reductase small subunit 2-like protein
• p53R2
• P53R2DKFZp686M05248
• PEOA5
• ribonucleoside-diphosphate reductase subunit M2 B
• ribonucleotide reductase M2 B (TP53 inducible)
• RRM2B
• TP53-inducible ribonucleotide reductase M2 B

Background

The p53 tumor-suppressor gene integrates numerous signals that control cell life and death. Several novel molecules involved in p53 signaling, including p53R2, Chk2, p53AIP1, Noxa, PIDD, and PID/MTA2, were recently discovered. p53R2 is a p53 inducible gene that contains a p53 binding sequence and encodes a subunit of the enzyme ribonucleotide reductase. p53R2 is induced by the reagents, ultraviolet and g-irradiation that cause DNA damages. The product of p53R2 gene is directly involved in the p53 checkpoint for repair of damaged DNA. The isoform of the p53 family member p73 also induces p53R2 expression. p53R2 is an important target of p53 for tumour suppression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p53R2 Antibody (H00050484-M01)(2)

Publications using H00050484-M01

• Park SJ, Kim HB, Piao C et al. p53R2 regulates thioredoxin reductase activity through interaction with TrxR2. Biochem Biophys Res Commun 2016-11-17 [PMID: 27866984]
• Piao C, Jin M, Kim HB et al. Ribonucleotide reductase small subunit p53R2 suppresses MEK-VERK activity by binding to ERK kinase 2. Oncogene. 2009-05-28 [PMID: 19398949]

Bioinformatics

• Gene Symbol: RRM2B
• OMIM:
  • 604712(Human)