p53 DINP1 Antibody

Images

 
Western Blot: p53 DINP1 Antibody [NBP1-68984] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Summary
Product Discontinued
View other related p53 DINP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-68984
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

p53 DINP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to TP53INP1 (tumor protein p53 inducible nuclear protein 1) The peptide sequence was selected from the C terminal of TP53INP1. Peptide sequence SFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQ.
Clonality
Polyclonal
Host
Rabbit
Gene
TP53INP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TP53INP1 and was validated on Western blot.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for p53 DINP1 Antibody

  • DKFZp434M1317
  • FLJ22139
  • p53DINP1
  • P53DINP1p53-dependent damage-inducible nuclear protein 1
  • p53-inducible p53DINP1
  • SIPStress-induced protein
  • Teap
  • TP53DINP1
  • TP53INP1A
  • TP53INP1B
  • tumor protein p53 inducible nuclear protein 1
  • tumor protein p53-inducible nuclear protein 1

Background

In response to double-strand DNA breaks, TP53INP1 promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. TP53INP1s and HIPK2 could be partners in regulating p53 activity. TP531NP1 plays a significant role in the progression of anaplastic carcinoma or contributes to anaplastic transformation from papillary or follicular carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98280
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1436
Species: Mu
Applications: WB

Publications for p53 DINP1 Antibody (NBP1-68984) (0)

There are no publications for p53 DINP1 Antibody (NBP1-68984).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p53 DINP1 Antibody (NBP1-68984) (0)

There are no reviews for p53 DINP1 Antibody (NBP1-68984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p53 DINP1 Antibody (NBP1-68984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p53 DINP1 Products

Bioinformatics Tool for p53 DINP1 Antibody (NBP1-68984)

Discover related pathways, diseases and genes to p53 DINP1 Antibody (NBP1-68984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p53 DINP1 Antibody (NBP1-68984)

Discover more about diseases related to p53 DINP1 Antibody (NBP1-68984).
 

Pathways for p53 DINP1 Antibody (NBP1-68984)

View related products by pathway.

PTMs for p53 DINP1 Antibody (NBP1-68984)

Learn more about PTMs related to p53 DINP1 Antibody (NBP1-68984).
 

Research Areas for p53 DINP1 Antibody (NBP1-68984)

Find related products by research area.

Blogs on p53 DINP1

There are no specific blogs for p53 DINP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p53 DINP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53INP1
Uniprot