p40 (p63 delta) Antibody

Images

 
Immunohistochemistry-Paraffin: p40 (p63 delta) Antibody [NBP1-88737] - Staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p40 (p63 delta) Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RABEPK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
p40 (p63 delta) Protein (NBP1-88737PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p40 (p63 delta) Antibody

  • 40 kDa Rab9 effector protein
  • bA65N13.1
  • p40
  • p40-p63 delta
  • Rab9 effector p40
  • Rab9 effector protein with kelch motifs
  • RAB9P40DKFZp686P1077
  • RABEPK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
AF4937
Species: Hu
Applications: WB, IHC

Publications for p40 (p63 delta) Antibody (NBP1-88737) (0)

There are no publications for p40 (p63 delta) Antibody (NBP1-88737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p40 (p63 delta) Antibody (NBP1-88737) (0)

There are no reviews for p40 (p63 delta) Antibody (NBP1-88737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for p40 (p63 delta) Antibody (NBP1-88737). (Showing 1 - 1 of 1 FAQ).

  1. Can I get a reference (published study) on the fixation and immunohistochemical handling of prostectomy specimens using NBP1-88737?
    • Unfortunately at this time I do not have any articles or publications that we have been made aware of for this product as of right now. I can send you over the recommended IHC protocol that the lab employed for this one if that would be helpful for you.

Secondary Antibodies

 

Isotype Controls

Additional p40 (p63 delta) Products

Bioinformatics Tool for p40 (p63 delta) Antibody (NBP1-88737)

Discover related pathways, diseases and genes to p40 (p63 delta) Antibody (NBP1-88737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p40 (p63 delta) Antibody (NBP1-88737)

Discover more about diseases related to p40 (p63 delta) Antibody (NBP1-88737).

Blogs on p40 (p63 delta)

There are no specific blogs for p40 (p63 delta), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p40 (p63 delta) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RABEPK