p38 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

p38 Recombinant Protein Summary

Description
P38 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Gene
MAPK14

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p38 Recombinant Protein

  • CSAID-binding protein
  • Csaids binding protein
  • CSBP
  • CSBP1MAX-interacting protein 2
  • CSBP2
  • CSPB1
  • cytokine suppressive inflammatory drug binding protein
  • Cytokine suppressive inflammatory drug-binding protein
  • EC 2.7.11
  • EC 2.7.11.24
  • EXIP
  • MAP kinase 14
  • MAP kinase MXI2
  • MAP kinase p38 alpha
  • MAPK 14
  • mitogen-activated protein kinase 14
  • Mitogen-activated protein kinase p38 alpha
  • Mxi2
  • p38 MAP kinase
  • p38 mitogen activated protein kinase
  • p38
  • p38alpha Exip
  • p38ALPHA
  • PRKM14
  • PRKM15
  • RK
  • SAPK2A
  • stress-activated protein kinase 2A

Background

MAPK14( AAH31574, 1 a.a. - 361 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NB100-1925
Species: Ce, Hu(-), Ma(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Flow, IHC, ICC
MAB8930
Species: Hu
Applications: WB, Simple Western, ICC
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB110-75039
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-45815
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
MAB8407
Species: Hu, Mu, Rt
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
H00001432-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for p38 Recombinant Protein (H00001432-P02) (0)

There are no publications for p38 Recombinant Protein (H00001432-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p38 Recombinant Protein (H00001432-P02) (0)

There are no reviews for p38 Recombinant Protein (H00001432-P02). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p38 Recombinant Protein (H00001432-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p38 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for p38 Recombinant Protein (H00001432-P02)

Discover related pathways, diseases and genes to p38 Recombinant Protein (H00001432-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p38 Recombinant Protein (H00001432-P02)

Discover more about diseases related to p38 Recombinant Protein (H00001432-P02).
 

Pathways for p38 Recombinant Protein (H00001432-P02)

View related products by pathway.

PTMs for p38 Recombinant Protein (H00001432-P02)

Learn more about PTMs related to p38 Recombinant Protein (H00001432-P02).
 

Research Areas for p38 Recombinant Protein (H00001432-P02)

Find related products by research area.

Blogs on p38.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MAPK14

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00001432-P02 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

p38 Recombinant Protein
H00001432-P01-10ug