p38 delta/SAPK4 Antibody

Images

 
Western Blot: p38 delta/SAPK4 Antibody [H00005603-D01P] - Analysis of MAPK13 expression in transfected 293T cell line by MAPK13 polyclonal antibody.Lane 1: MAPK13 transfected lysate(42.10 KDa).Lane 2: Non-transfected ...read more
Proximity Ligation Assay: p38 delta/SAPK4 Antibody [H00005603-D01P] - Analysis of protein-protein interactions between MAPK13 and MAPKAPK3. HeLa cells were stained with anti-MAPK13 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Product Discontinued
View other related p38 delta/SAPK4 Primary Antibodies

Order Details


    • Catalog Number
      H00005603-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

p38 delta/SAPK4 Antibody Summary

Immunogen
MAPK13 (NP_002745.1, 1 a.a. - 365 a.a.) full-length human protein. MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Specificity
MAPK13,
Clonality
Polyclonal
Host
Rabbit
Gene
MAPK13
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p38 delta/SAPK4 Antibody

  • EC 2.7.11
  • EC 2.7.11.24
  • MAP kinase 13
  • MAPK 13
  • MAPK13
  • MGC99536
  • mitogen-activated protein kinase 13
  • Mitogen-activated protein kinase p38 delta
  • p38 delta
  • p38delta
  • PRKM13
  • SAPK4MAP kinase p38 delta
  • Stress-activated protein kinase 4

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-56446
Species: Hu, Mu, Rt
Applications: WB
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005603-D01P
Species: Hu
Applications: WB, PLA

Publications for p38 delta/SAPK4 Antibody (H00005603-D01P) (0)

There are no publications for p38 delta/SAPK4 Antibody (H00005603-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p38 delta/SAPK4 Antibody (H00005603-D01P) (0)

There are no reviews for p38 delta/SAPK4 Antibody (H00005603-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p38 delta/SAPK4 Antibody (H00005603-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p38 delta/SAPK4 Products

Bioinformatics Tool for p38 delta/SAPK4 Antibody (H00005603-D01P)

Discover related pathways, diseases and genes to p38 delta/SAPK4 Antibody (H00005603-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p38 delta/SAPK4 Antibody (H00005603-D01P)

Discover more about diseases related to p38 delta/SAPK4 Antibody (H00005603-D01P).
 

Pathways for p38 delta/SAPK4 Antibody (H00005603-D01P)

View related products by pathway.

PTMs for p38 delta/SAPK4 Antibody (H00005603-D01P)

Learn more about PTMs related to p38 delta/SAPK4 Antibody (H00005603-D01P).
 

Research Areas for p38 delta/SAPK4 Antibody (H00005603-D01P)

Find related products by research area.

Blogs on p38 delta/SAPK4

There are no specific blogs for p38 delta/SAPK4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p38 delta/SAPK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK13
Entrez
Uniprot