Recombinant Human P2Y1/P2RY1 Protein

Images

 
There are currently no images for P2Y1/P2RY1 Recombinant Protein (H00005028-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

Recombinant Human P2Y1/P2RY1 Protein Summary

Description
P2Y1/P2RY1 (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
P2RY1

Applications/Dilutions

Application Notes
This product is recommended to use in Functional study and Compund screening, not validated yet.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human P2Y1/P2RY1 Protein

  • ATP receptor
  • P2 purinoceptor subtype Y1
  • P2RY1
  • P2Y purinoceptor 1
  • P2Y1
  • P2Y1platelet ADP receptor
  • purinergic receptor P2Y, G-protein coupled, 1
  • Purinergic receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33870
Species: Hu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NLS877
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
NLS5011
Species: Hu, Mk, Pm
Applications: IHC-P
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1658
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37382
Species: Hu
Applications: WB, ELISA, Flow
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for P2Y1/P2RY1 Recombinant Protein (H00005028-G01) (0)

There are no publications for P2Y1/P2RY1 Recombinant Protein (H00005028-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2Y1/P2RY1 Recombinant Protein (H00005028-G01) (0)

There are no reviews for P2Y1/P2RY1 Recombinant Protein (H00005028-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for P2Y1/P2RY1 Recombinant Protein (H00005028-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human P2Y1/P2RY1 Protein Products

Related Products by Gene

Bioinformatics Tool for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

Discover related pathways, diseases and genes to P2Y1/P2RY1 Recombinant Protein (H00005028-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

Discover more about diseases related to P2Y1/P2RY1 Recombinant Protein (H00005028-G01).
 

Pathways for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

View related products by pathway.

PTMs for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

Learn more about PTMs related to P2Y1/P2RY1 Recombinant Protein (H00005028-G01).
 

Research Areas for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

Find related products by research area.

Blogs on P2Y1/P2RY1

There are no specific blogs for P2Y1/P2RY1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human P2Y1/P2RY1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RY1
Entrez

Customers Who Bought This Also Bought

P2Y2 Antibody
NB110-39032
P2Y2 Antibody
NB110-39032
P2Y2 Antibody
NB110-39032