Recombinant Human P2Y1/P2RY1 Protein

Images

 
There are currently no images for P2Y1/P2RY1 Recombinant Protein (H00005028-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

Recombinant Human P2Y1/P2RY1 Protein Summary

Description
P2Y1/P2RY1 (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
P2RY1

Applications/Dilutions

Application Notes
This product is recommended to use in Functional study and Compund screening, not validated yet.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human P2Y1/P2RY1 Protein

  • ATP receptor
  • P2 purinoceptor subtype Y1
  • P2RY1
  • P2Y purinoceptor 1
  • P2Y1
  • P2Y1platelet ADP receptor
  • purinergic receptor P2Y, G-protein coupled, 1
  • Purinergic receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78249
Species: Hu, Rt, Pm
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-33688
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NLS877
Species: Hu, Mk, Pm
Applications: IHC-P, ICC
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1658
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NBP2-37382
Species: Hu
Applications: WB, ELISA, Flow
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46808
Species: Hu
Applications: WB, IHC, IHC-P

Publications for P2Y1/P2RY1 Recombinant Protein (H00005028-G01) (0)

There are no publications for P2Y1/P2RY1 Recombinant Protein (H00005028-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2Y1/P2RY1 Recombinant Protein (H00005028-G01) (0)

There are no reviews for P2Y1/P2RY1 Recombinant Protein (H00005028-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for P2Y1/P2RY1 Recombinant Protein (H00005028-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human P2Y1/P2RY1 Protein Products

Related Products by Gene

Bioinformatics Tool for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

Discover related pathways, diseases and genes to P2Y1/P2RY1 Recombinant Protein (H00005028-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

Discover more about diseases related to P2Y1/P2RY1 Recombinant Protein (H00005028-G01).
 

Pathways for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

View related products by pathway.

PTMs for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

Learn more about PTMs related to P2Y1/P2RY1 Recombinant Protein (H00005028-G01).
 

Research Areas for P2Y1/P2RY1 Recombinant Protein (H00005028-G01)

Find related products by research area.

Blogs on P2Y1/P2RY1

There are no specific blogs for P2Y1/P2RY1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human P2Y1/P2RY1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RY1
Entrez

Customers Who Bought This Also Bought